SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam L    

ID / Description / Sequence
1 >lcl|NP_001003031.1|Plus143265826..43266716 NW_879563 protein phosphatase 2A inhibitor 2-like SET __SEG__ ChrX {Canis lupus familiaris} MAPKRQSSLAPQMKKPRLLPAPMPEEMSASQPLPNGEKEQQEVIEHIDEVQNEIDRLNEEASEEILKVEQKYNKLCQPFFQRRSELIPKIPNFWVTTFVNHPQVSVLLGE
EDEEALHYLTRVEVTESEDIKSGYRIDFYFDENPYFKNKVLSKEFHLNENGDPSSRSTEIKWKSGKDLTKQSSQMQNKASRKREYEEPEGFFTWFTDHSDAGADELGEII
KDDIWPNPLQYYLVPDTDEEEEEEEEEEEEDVDDDDDDEGLEDIDERDEGEDEDDDDDDDDDDDEGEEGEEDEDDDD
2 >lcl|NP_001091451.1|Plus1complement(34199050..34201134) NW_876273 zinc finger BED domain-containing protein 5 ZBED5 __SEG__ Chr21 {Canis lupus familiaris} MIAHLLCILSYNFNTSVILNVYSKLTMFCTTNTLPMDLLLKQGSLKQEVESFCYQIVSESNDQKVGILQSENEQLQPSVSKKSEGELSRVKFMSSSNKITTFSKKPKRRK
YDESYLSFGFTYFGNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIK
PCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVRYRFNKSIEEDLLLCESLQSNATGEEIFNCINSFMQ
KHEIEWEKCVDVCSDASRAMDGKIAEAVTLIKYVAPESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQHTALLLNTEVRWLSRGK
VLVRLFELRRELLVFMDSAFRLSDCLTNSSWLLRLAYLADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTEINSTVDKDICSAI
VQHLRGLRSTLLKYFPVTNDNNTWVRNPFTVTVKPASLVARDYESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPSIARRAVRVLLPFATMHLCETGFSYYAATKTKYR
KRLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH*
3 >lcl|XP_003432236.1|Plus130811486..30811851 NW_876263 barrier-to-autointegration factor-like LOC100685356 __SEG__ Chr17 {Canis lupus familiaris} MTTSQKHRDFVAEPMGQKPVGSLAGIGEVLGKKLEERGLDKASVLLGQFLVLKKDEDLFREWLKDTCGANAKQSRDAPGAFDSGEPPAPSPSMQSPEFAAAWGLLPCPLL
YKGRDCCCTHF*
4 >lcl|XP_003434351.1|Plus1462213..465158 NW_876305 zinc finger BED domain-containing protein 6-like LOC100682640 __SEG__ Chr38 {Canis lupus familiaris} MSVCTLSVPVSSLSPGRRCNTFSDAGILGCVPIDANTDEEDVVEGKMVAEGMDKEAKLPAKKKRKKGLRIKGKRRRKKLILAKKFSKDLGSGRPVADAPALLASSAHEQD
EEGLFESNIEKQIYLPSTRAKTSIVWHFFHVDPQYTWRAICNLCEKSVSRGKPGSHLGTSTLQRHLQARHSPHWTRANKFGVTSGEEDFTLDVPLSPSSAGSNGSFEYMS
TDPLDENRMGKKRDKSVSDALRAERGRFLIKSNIVKHALIPGTRAKTSAVWNFFYTDPQHISRAVCNICKRSVSRGRPGSHLGTSTLQRHLQATHPIHWAVANKDSGAVG
NGLDEAETERNDLLSDPLHGEKSTGSHDLTAEDLSDSDSDEPPVLEVENSRRSESPIPVAEQDTLTHAQEGETTYSENSVSSQISQAIIQMIVEDMHPYNYFSTPAFQRF
MQIVAPDYRLPSETYFFTKAVPQLYDWVREKIFLTLENVQSQKIHLTVDIWTHDPSTDYFIVTVHWVSLETAPSSSNGRIPNFRKWAVLCVTGLAKDCLITNILQELNDQ
IGLWLSPNFLIPSFIVSDNSSNVVHAIKDGGFTHVPCFLHCLNIVIQDFFCEHKSIENMLVAARKTCHHFSHSVKARQILQEFQNDHQLPWKNLKQDETGHWISTFYMLK
WLLEHCYSVHHSLGRASGVVLTSLQWTLMTYVCDILKPFEEATQKVSVKTTGLNQVLPLIHHLLLSLQKLREDFQIRGITQALNLVDSLSLKLETDTLLSAMLKSKPCVL
AALLDPCFKNSLEDFFPQGADLETYKQILAEEVCNYMESSEVCHIATSDAAGPSAIVGADSFTSSIREGASSSGSFDSSAADNVAVGSKSFMFPSAIAVVDEYFKEKYSE
ISGGGDPLIYWQRKVSIWPALTQVAIQYLSCPMCSWQSECIFTANSQFHPKQIMSLDFDNIEQLMFLKMNLKNVNYDYSTLVLSWDPGNEVIQSNEKEILQ*
5 >lcl|XP_003435539.1|Plus1complement(23151816..23152688) NW_879562 protein SET-like LOC608403 __SEG__ ChrX {Canis lupus familiaris} MAPKRQSSLAPQTKKPRLPLAPKPEETSTSQHLPKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQNYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSSLLGE
EDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLFKEFHLNESGDPSSKSTEIKWKSGKDLMKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVI
KDGIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD*
6 >lcl|XP_533179.3|Plus1complement(14343235..14344755) NW_876266 LOW QUALITY PROTEIN: THUMP domain-containing protein 3 THUMPD3 __SEG__ Chr18 {Canis lupus familiaris} MSDVQEATNQLLDVSLHEHQKSIPVTGSGPRSESQHLQVTIGATVPTGFEQTAADEVREKLGSSCKISKDRGKIYFDISVESLAQVHCLRSVDNLFVVVKEFKDYPFKET
KEEVLKDFEELAGKLPWSDPLKVWKINTSFKKKKTKRKKINQNSSKEKTNNGQGDKTDERDDKKGFINNTLDSHILDYYENPAIKEEVSTLVGDDLASCKDEKDESSKEE
TQPELLKFRVTCNRAGEKHCFSSNEAARDFGGAIQDYFKWKADMTNFDVEVLLNIHDKEIVVGIALTEESLHRRNITHFGPTTLRSTLAYGMLRLCAPQPTDIIVDPMCG
TGTIPIEGATEWSNCYHIAGDNNPLAVNRAANNISSLLTKSQIKEGKVSWGLPIDAVQWDICNLPLRTGSVDIIVTDMPFGKRMGSKKRNWNLYPACLREMSRVCRPGTG
RAALLTQDKKCFAKALSGMGHVWRKIHTVWVNIGGLHAAVYLLKRTPQAFIHPSEQDGERTPW*CK*
7 >lcl|XP_533271.1|Plus1complement(29389689..29390831) NW_876266 flap endonuclease 1 isoform 1 FEN1 __SEG__ Chr18 {Canis lupus familiaris} MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQ
LQQAQAAGAEEEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLNRILQELGLNQ
EQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAQQLFLEPEVLDPESVELKWSEPNEEELVKFMCGEKQFSEERIRSGVRRLSK
SRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGSAKKKAKTGVAGKFKRGK*
8 >lcl|XP_538318.3|Plus1complement(755925..759422) NW_876251 zinc finger BED domain-containing protein 4 ZBED4 __SEG__ Chr10 {Canis lupus familiaris} MENNQETRPRRDGEFVSDKINFKIEEEDDVQIPNPSLEGVEFKAEPDGNRAEGGGGRAEARGPPGKCPAADQEEEYGSLFSQYSSTLYDVAMEAVTQSLLSGRAVSSRKK
SPAWKHFFISPRDSTKAICTYCMKEFSRGKNEKDLSTSCLMRHVRRAHPTVLVQENGSVPGLPSLSPPPLRLPPQPTDPGDLGAVLSPVSLAPKLALKAPSPDDMMEEST
SAVSLEETPSDAPASDKYGREEAPGGPPPMPPLPCEDSAENGAERNPPPPKSTSGSRRRSAVWKHFYLSPLDNSKAVCIHCMNEFSRGKNGKDLGTSCLIRHMWRAHRSI
VLQENGGSGLPPPYAAPPTLLPALPPPDGDPSSVSSSPGKLVQESPSASSSPDRLTEDLQVHLHAGDTLMEDASALSSDDVGEASLASSPEKPQAGGMSPSLLECGAVFQ
QNKKVMKRLKSEVWQHFSLAPMDSLKAVCRHCACIISRGKRGDVGTSCLMRHLYRRHPDVVSNQKGSLGAGLANSPYATLASAESSSSKLTDLPSMVTKNNQVLFPVNSK
KTSKLWNHFSICSADPTKVVCLHCGRTISRGKKPTNLGTSCLLRHLQRFHGSVLKPDVPRAARASSPSLRGPLSTQLSGASSFDDTNEKFYDSHPVAKKITSLIAEMIAL
DLQPYSFVDNVGFNRLLEYLKPQYSLPSPSYFSRTAIPGMYDNVKQIVLSHLKEAESGVIHFTSGIWMSNQTREYLTLTAHWVTFASSARPYCEDHHCSALLDVSQVDCD
YSGNSIRKQLECWWEAWVTSTGLQIGITVTDNPSIGKTLSEGERASVQCFSHTVNLVVSEAIKSQRMVQNLLSIARKICERVHRSPKAKEKLAELQKEYELPQHHLIQDV
PSKWNTSFHMLERLIEQKRAINEMSIECNFRELISCDQWEVMQSVCHALKPFDAASREMSTHVSTLSQVIPMIHILNRKIEMLFEETMGIDTMLKSLKEAMVSRLAATLH
DPRYIFATLLDPRYKASLFSEEEAEQYKQDLIRELEVLNSTSEDTPVSNGCDPGSPSKDAVGEENLWSLMAKMTKKGPREKTKVPEDMVLAYLEEEVLEHSCDPLTYWNL
KKSAWPGLSTLAVRFLGCPPSIVPSERLFSTPTENGGFGQSRLTMEHFEKLIFLKVNLPLIYFQY*
9 >lcl|XP_539094.3|Plus1complement(71953956..71955152) NW_876254 TSPY-like 4 TSPYL4 __SEG__ Chr12 {Canis lupus familiaris} MSAPAEGRHLPAARDCGAAAAEADPAPGPPDATPGRAEGMADAGEGGVQTAAGGAPARSPAGGAPALRVRVFGSRGRGAGRAGPRERLLPAEGSAAAGAQEHGCPRREPR
GPAAEKALEACGAGASGAQGAQGAPGAKAKELPAKCAAEGEGAAAGAAEDGQAMPKEKGAAGTQEEARAKAPKVGSCMDSLEAIDQELSNVNAQADRAFLQLERKFGRMR
RLHMQRRSFIIQNIPGFWVTAFRNHPQLAPMISGQDEDMMRYMINLEVEELKHPRAGCKFKFIFQGNPYFRNEGLVKEYERRSSGRVVSLATPIRWHRGQDPQAHIHRNR
EGSTIPSFFNWFSDHSLLEFDRIAEIIKAELWPNPLQYYLMGEGPRRGIRDPARQPAESPRSFRFQSG*
10 >lcl|XP_542238.3|Plus1complement(5987548..5989503) NW_876273 lysine-specific demethylase 4D-like LOC485120 __SEG__ Chr21 {Canis lupus familiaris} MKSKHYGTQNPSFTVMTFHPTMQEFKDFNKYIAYMESQGAHRAGLAKVIPPKEWKARQNYDDISDILIATPLQQVVSGQAGVFTQYHKKKRATTVGEYRQLANSIKYWTP
PHLDFEDLERKYWKTRLYDSPIYGADISGSLFDENTKEWNLGHLGTIQDLLEQECGVVIEGVNTPYLYFGMWKTAFAWHTEDMDLYSINYLHFGQPKTWYAVPPEHGQRL
ERLARELFPGSARTCEAFLRHKVALISPTVLRDSGIPFSRVTQEAGEFMVTFPYGYHSGFNHGFNCAEAINFATARWIDYGKVASQCSCGEARVTFSMDAFVRILQPERY
ELWKRGQDRAAVDHTEPTAADSRELSAWRGVRAPGRAALGLRHLPPRRAPRAPRPVAAGQGTRRRAPLRPASPRPSPTQSSSAGRAGAVAGRTSRGPGPTRPPTLTPSAP
DLQPSTGRCGPGRRPREQGAQGSGTQARAKRRLSVGTGHTAQHSEAQPPPVGGGWMHSPAPLSPGFPVYAEASGCCCAPDLQPLGPPLDPDNPMHPGPCLLSLDRITVNF
SDSVPLAPPEVAGMLRFPRHAWGDSRAPVNLSEIVMMDHTYASMDLTPAPVASSPCIPDCDPLELKPQAVSIFEPYDVFSPDRRALAFELMAIEDIAHDPY*
11 >lcl|XP_542239.1|Plus1complement(6002235..6003809) NW_876273 lysine-specific demethylase 4D-like LOC485121 __SEG__ Chr21 {Canis lupus familiaris} MEAMKSKANCAQNASCTIMIFHPTKEEFNDFDKYIAYMESQGAHRAGLAKVIPPKEWKARQNYDDISDILIATPLQQVVSGQAGVFTQYHKKKRATTVGEYRQLANSIKY
RTPPHLDFEDLERKYWKTRLYDSPIYGADISGSLFDENTKEWNLGHLGTIQDLLEQECGVVIEGVNTPYLYFGMWKTAFAWHTEDMDLYSINYLHFGQPKTWYAVPPEHG
QRLERLARELFPGSARTCEAFLRHKVALISPTVLRDSGIPFSRVTQEAGEFMVTFPYGYHSGFNHGFNCAEAINFATARWIDYGKVASQCSCGEARVTFSMDAFVRILQP
ERYELWKRGQDRAAVDHTEPTAADSRELSAWRGVRAPGRAALGLRHLPPRRAPRAPRPVAAGQGTRRRAPLRPASPRPSPTQSSSAGRAGAVAGRTSRGPGPTRPPTLTP
SAPDLQPSTGRCGPGRRPREQGAQGSGTQARAKRRLSVGTGHTAQHSEAQPPPVGGGWMHSPAPLSPGLQQPAEASWSACAPVP*
12 >lcl|XP_542663.2|Plus1complement(1320783..1323518) NW_876275 DNA ligase 4 LIG4 __SEG__ Chr22 {Canis lupus familiaris} MAATQTSQTVASHVPFADLCSTLERIQRSKGREEKIRHFREFLDSWRRFHDALHKNQKDVRDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPKEGKDALKLL
NYRTPTGTRGDAGDFATIAYFVLKPRCLQKGSLTIQQVNDILDSIASNNSARKKDLIKKSLLQLITQSSALEQKWLIRMIVKDLKLGFSEQSVFSAFHNDAAELHNVTTD
LEKVCRQLHDPSIGLSDISITLFSAFKPMLAAIADIERIEKDMKHQSFYIETKLDGERMQMHKDGDVYQYFSRNGYNYTDQFGDSPREGSLTPFIHSAFKTDVQICILDG
EMMAFNPNTQTFMQKGNKFDIKRMVEDSDLQTCYCVFDVLMVNNKKLGRETLKKRYEILTSVFTPIPGRIEIVQKTQAHTKKEVIDALNEAIDKREEGIMIKHPLSIYKP
DKRGEGWLKIKPEYVDGLMDELDILIVGGYWGKGSRGGMMSHFLCAVAEKPPPGEKPSVFHTLCRVGSGYTMKELYDLGLKLAKHWKPFHKKALPSSILCGTEKPEVYIE
PCNSVIVQVKATEIVSSDMYKTGCTLRFPRIEKIREDKEWHECTTVDDLEQLRGKASGKLASKHLDIGGDDEPQEKKRKAAPKIKKIIGIIEHLKAPNLSNINKVSNIFE
DVEFCVMSGTDSHPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSENIRVKNIISSNKHDVVKPEWLLECFKTKSCVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFVDLD
LNQLKEVFSGIKNSSKQTPREMASLIADLEYRYSWDRSPLCLFRHCIVYLDLYAVINDLSTKIEGTRLAITALELRFHGAKVVSCLAQGVSHVIIGEDHSRVAVLKSFRR
TLKRKFKILQQDWVTESIDKCELQEENQYLV*
13 >lcl|XP_544191.3|Plus1complement(41489956..41490600) NW_876288 testis-specific Y-encoded-like protein 5-like TSPYL5 __SEG__ Chr29 {Canis lupus familiaris} MDTLETVQLKLETMNAQADRAYLRLSRKFGQLRLHHLERRNLLIQSIPGFWGRAFQNHPQLSSFLNSQDREALGYLNSLEVEELGLARLGYKIKFYFGRNPYFQNKVLIK
EYGCGPSGQVVSRSTPIQWLPGHDLQSLSQGSPDNSRSFFGWFSNHSSIESDKIVEIINEELWPNPLQYYLMSEGARAEKGKEGRPGPARPDPEAPKPGAPESI*
14 >lcl|XP_548835.3|Plus1complement(1159682..1161775) NW_879562 zinc finger BED domain-containing protein 1 ZBED1 __SEG__ ChrX {Canis lupus familiaris} MEAKGLDPSQTDLKLVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNTSNLSYHLEKNHPDEFCEFVKSNTEQMREAFATAFSKLKPEASQLTPPDSL
ATKAGHGHESKRQQELTAAVIGLICEGLYPASIVDEPTFKVLLKTADPRYEMPSRKYLCSKAIPEKYGAVREAVLKELGDASWCGISTDMWRSDNQNRAYVTLAAHFLGG
GAPGCLSVGSRCLKTFEVPEDNTAESITRVLYEAFIEWGISAKVFGATTDCGKDIVKACSLLDISVQMPCLGHTFNAGIQQALQLPKLAGLLARCRKLVEYFQQSTVAMY
MLYEKQKQQNMAHCMLVSNRVAWWGSTLAMLQRLKEQQFVIAGVLVEDSNNHHLMLETAEWATIEGLVDLLQPFKQVAEMLSASKYPTISMVKPLLHMLLNTTLNIKETD
CKEVSMAKEVIAKELSKTYQETPEIDMFLNVATFLDPRYKRLPFLSAFERQQVENRVVEEAKGLLDKVKDGGYRPAATAEDKMYALPEEPPVKKLVLASTPPPTSVINSM
LAEIFCQTGGVEDQEEWHAQVVEELSNFKSQKVLGLNEDPLKWWSDRLALFPVLPKVLQKYWCVAATRVFPERLFGSSANVVSAKRNRLAPAHVDEQIFLYENARTGAEA
EPEDEDEGEWGLDHEQVFPLGDAVHAGFFGIRDSGFV*
15 >lcl|XP_549356.2|Plus1complement(72638808..72639518) NW_879563 three prime repair exonuclease 2 TREX2 __SEG__ ChrX {Canis lupus familiaris} MSEAPRAETFVFLDLEATGLPNIDPEVAEISLFAVHRSSLENPDRDESGAPVVPRVLDKLTLCMSPERPFTAKASEITGLSSDSLARCRKAGFDHAVVRTLQAFLSRQEG
PVCLVAHNGFDYDFPLLCTELRRLGAHLPPDTTCLDTLPALRSLDRAHSHGTRAQGCKGYSLGSLFRRYFRAEPSAAHSAEGDVHTLLMVFLHRAAELLGWADERARSWA
HIEPMYVPPDGPSVEA*
16 >lcl|XP_848341.1|Plus1376919..377905 NW_876299 coiled-coil domain-containing protein 54 CCDC54 __SEG__ Chr33 {Canis lupus familiaris} MYRLQTKRAKAAAGQMWTSNLSKIRRSLKNVYHKYKNQHPDSTRDPTSTSYDCDKDDITTDEEMSLRAMLQYIKTAQIELVSQLTDIVSVVSKIQEKIDFYQKQIDILET
RMNINEDKQGTITKDIFSMKKDINALKKKVTELENQNPCSTIHCLEVPEGERGKEIIEQLHKLIQPETLKNTLASTDYGISSAEPENVPSYPELTDHLEEKTISPKVKTL
GKNNHQNALRSFKKAKSNIYIYPDFSTWIKLTFVHGGKWRFFLSATELEEFIQWLLSRPAISPEEPQLVTQRYCPFTGLISSLTTFCLSVLNYIYCFFGSSKEEITRL*
17 >lcl|XP_854523.2|Plus1complement(27985143..27986345) NW_876312 protein DDI1 homolog 1 DDI1 __SEG__ Chr5 {Canis lupus familiaris} MLITVYCVRRDLSEATFSLQVNPDFELHNFRLLCELESGIPVDEIQIIFMERLLTDDRCSLGSYGLRDGDVVVLLQRESAGPRPHGRTSSLLQVDFTRLAVPGTSSSRQQ
QQQQQRAPSAQQSHGLDSGEKMTPTQGLDSPALIRSMLLSNPHDLSLLKERNPPLAEALLSGNLDTFSHVLMEQQRERALREQERLRLYTADPFDLEAQAKIEEEIRQQN
IEENMNIAMEEAPESFGQVAMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIIRLVDRRWAGIAKGVGTQRIIGRVHLAQIQIEGDFLQCSFSILEEQPMDMLLGL
DMLRRHQCSIDLKKNVLVIGTTGTQTPFLPEGELPLCAKLVSSAGQQESPDKEGADTIKHSVMDLGWRKH*