SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau L    

ID / Description / Sequence
1 >lcl|NP_001030285.1|Plus11122931..1124073 NW_001494536 flap endonuclease 1 FEN1 __SEG__ Chr29 {Bos taurus} MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQ
LQEAQAAGAEAEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQ
EQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAQQLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVRRLSK
SRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGAAKKKAKTGAAGKFKRGK*
2 >lcl|NP_001069579.1|Plus1994004..995302 NW_001495560 testis-specific Y-encoded-like protein 1 TSPYL1 __SEG__ Chr9 {Bos taurus} MSGRDGGERTPLLEAHSLTTSDCAAGAPDPSRCLKTEASQVMAETGEGYFEAVALPPPQLPEEESAPSTAPSDPGCAGTFQIRAGGDGGYVVPEARLEPAPPPTESLETA
SVSLATDDSLGNGCQPGEPQGLSREKPLETCGAEKLGSDLMAEAKAEEVKTEEGPVFSVAVDEEVVGKEGAKEEEGVEQGMEVEERPVGEEIEMVENRVVEEAGHRPLRM
DLRMNPLEAIQLELDSVNAQADRAFQQLEHKFGRMRRHYLERRNYIIQNIPGFWVTAFRNHPQLSPMIRGQDAEMLRYITNLEVKELRHPRTGCKFKFFFRRNPYFRNKL
IVKEYEVRASGRVVSLSTPIIWRRGHEPQSFIRRNQEVVCNFFTWFSDHSLPESDRIAEIIKEDLWPNPLQYYLLREGVRRARRRPIREPVEIPRPFGFQSG*
3 >lcl|NP_001071488.1|Plus1complement(331011..332201) NW_001493273 protein DDI1 homolog 1 DDI1 __SEG__ Chr15 {Bos taurus} MLLTVYCVRRDLSEATFSLQVRPDFELHNFRVLCELESGIPAEETQIVYMERLLVNDHCSLGSYGLKDGDMVILLQKEAMRPRSPERAAGLCSMEPAGPALPGTSGSRPH
QRTQSAQHSSRRGSGEKAGPGQGLDSPALVRSMLLSSPHDLSLLKERNPSLAEALLSGNLESFSQVLMEQQRERALREQERLRLFSADPFDLEAQAKIEEEIRQQNIEEN
MSIAMEEAPESFGQVAMLYINCRVNGHPLKAFVDSGAQMTIMNQVCAERCNIIRLVDRRWAGVAKGVGTQRILGRVHLAQIQIEGDFLQCSFSILEEQPMDMLLGLDMLR
RHQCSIDLKRNVLVIGTTGTQTSFLPEGELPPCAKLVSGMGPEESSDKETANAIKHSVMDSGRKKH*
4 >lcl|NP_001092858.1|Plus11702895..1704979 NW_001493312 zinc finger BED domain-containing protein 5 ZBED5 __SEG__ Chr15 {Bos taurus} MIAHFLCILSYNVNTFVILNVYTKLTMFCTTNSLPMDLLLKQGSLKQEVESFCYQIVSESHDQKVGILQSEDEHLQPSVSKNSEGELSRVKFISNSNKITTFSKKPKRRK
YDESYLSFGFTYFGNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIK
PCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVRYRFNKSIEEDLLLCESLQSNATGEEIFNCINSFMQ
KHEIEWEKCVDVCSDASRAMDGKIAEAVTLIKYVAPESTSSHCLLYRHALAVKTMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQHTALLLNTEVRWLSRGK
VLVRLFELRRELLVFMDSAFRLSDCLTNSSWLLRLAYLADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTEINSTVDKNICSAI
VQHLRGLRSTLLKYFPVTNDIHAWVRNPFTVTVKPASLVARDYESLIDLTSDSQVKQSFSELSLNDFWSSLIQEYPSVARRAVRVLLPFATMHLCETGFSYYAATKTKYR
KRLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH*
5 >lcl|NP_001094534.1|Plus11011586..1012830 NW_001495560 TSPY-like 4 TSPYL4 __SEG__ Chr9 {Bos taurus} MSGLDEGDSLPVAKTCGPATPDHAPGHPDFKQCQSEETEATSVMADTGEGGLETAAEGGAAQDPAVCGLALRIRVAGSRGRVATKAGQKEAPASTEGLEAASASTSVGAD
NSQENGCQRRELRSPAIEKALEACDAGSLAAQMLPRAKAKEMTTKKCAVSAAGEKEGVTEEVVEGKKVIQKEKKVVGGAKEETRARAPKINNCMDSLEAIDQELSNVNAQ
ADRAFLQLERKFGRMRRLHMQRRSFIIQNIPGFWVTAFRNHPQLSPMISGQDEDMMRYMINLEVEELKHPRAGCKFKFIFQSNPYFRNEGLVKEYERRSSGRVVSLSTPI
RWHRGQDPQSHIHRNREGNTIPSFFNWFSDHSLLEFDRIAEIIKAELWPNPLQYYLMGDGPRRGFRDPARQPVESSRTFRFQSG*
6 >lcl|NP_776900.2|Plus1229195..230142 NW_001494125 three prime repair exonuclease 1 TREX1 __SEG__ Chr22 {Bos taurus} MGSRALPPGPVQTLIFLDLEATGLPFSQPKITELCLLAVHRYALEGLSAPQGPSPTAPVPPRVLDKLSLCVAPGKVCSPAASEITGLSTAVLAAHGRRAFDADLVNLIRT
FLQRQPQPWCLVAHNGDRYDFPLLRAELALLGLASALDDAFCVDSITALKALEPTGSSSEHGPRKSYSLGSVYTRLYGQAPPDSHTAEGDVLALLSVCQWRPRALLRWVD
AHAKPFSTVKPMYVITTSTGTNPRPSAVTATVPLARASDTGPNLRGDRSPKPAPSPKMCPGAPPGEGLLAPLGLLAFLTLAVAMLYGLSLAMPGQ*
7 >lcl|XP_001249517.1|Plus1complement(398822..401557) NW_001493091 ligase IV, DNA, ATP-dependent LIG4 __SEG__ Chr12 {Bos taurus} MAASQTSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFKAFLDSWRKFHNALHKNQKDVTDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLL
NYRTPTGTRGDAGDFAMIAYFVLKPRCLQKGSLSIQQVNDILDSIASNNSAKRKDLMKKSVLQLITQSSALEQKWLIRMIVKDLKLGFSQQTIFSIFHSDAAELHNVTTD
LEKVCRQLHDPSVGLSDISITLFSAFKPMLAAIADIERIEKDMKHQSFYIETKLDGERMQMHKDGDVYRYFSRNGYNYVDQFGASPQEGSLTPFIHNAFKTEVLNCILDG
EMMAYNPNTQTFMQKGNKFDIKRMVEDSELQTCYCVFDVLMVNDKKLGHETLRKRYEILNSVFTPVPGRIEIVQKTQAHTKKEVIDALNEAIDKREEGIMVKHPLSIYKP
DKRGEGWLKIKPEYVNGLMDELDILIIGGYWGKGARGGMMSHFLCAVSEKPPSGEKPSVFHTLCRVGSGYTMKELYDLGLKLAKHWKPFHRKAPPSNILCGTEKPEVYIE
PCNSVIVQVKATEIVPSDMYKTGCTLRFPRIEKIREDKEWYECTSLEDLEQLRGKACGKLASRHLYLGGDDEPQEKKRKAAPKMKKVIGIIEHLKAPNLSNVNRVSTVFE
DVEFCVMSGTSSHPKPDLENRIAELGGYIVQNPGPDTYCVIAGSENIRVKNIISSDKHDVVKPEWLLECFRTRSCVPWQPRFMIHMCPSTKQHFAQEYDQYGDSYFVDTD
LHQLKEVFLGIKNAGEQTPGEMSPVIADLEHRYSWASAPLSMFRHLTVYLDLYAVINDLSTRIKGARLAITALELRFHGAQVVSCLAEGVSHVIVGEDQSRVADLKAIRR
TLKRKFKILQERWVTVSIDKCELQEENRYLV*
8 >lcl|XP_001790011.1|Plus1573021..575963 NW_001493378 zinc finger, BED-type containing 1-like LOC100140288 __SEG__ Chr16 {Bos taurus} MSVCTLSVPVSSLSPGRRCSTFSGAGILGCVPVTSNTDEEDVVEGKMVAEGMDKEAELPTKKKRKKGLRIKGKRRRKKLILAKKFSKDLVSGRPVADAPTLLASSAPEQD
EESLFESNIEKQIYLPSTRAKTSIVWHFFHVDPQYTWRAICNLCEKSVSRGKPGSHLGTSTLQRHLQARHSPHWTRANKFGVTSGEEDFTLDAPLSPSSAGSSGSFEYIP
ADPLDNAMGKKRDKSVSDALRAQRGRFLIKSNIVKHALIPGTRAKTSAVWNFFYTDPQHISRAVCNICKRSVSRGRPGSHLGTSTLQRHLQATHPIHWAVANKDSGAVGN
GLDEAETERNDLLSDSLHGERSAGSQDVAAEHLSDSDSDEPPVLEVENRRSESPTPVAEQDTQMHAQEQETAYCENSTPSQISQAIIQMIVEDMHPYNYFSTPAFQRFLQ
IVAPDYRLPSETFFFTKAVPRLYDSVREKIFLTLENVQTQKIHLTVDIWTHDPSTDYFIVTVHWVSLETTPSFNNGRIPNFRRWAVLCVTGLAKNCLITNILQELNDQIG
LWLSPNFLIPSFIVSDSSSNVVHAVKDGGFTHVPCFLRCLNIVIQDFFCEHKSIENMLVAARKTCHHFSHSVKARQILQEFQNDHQLPWKNLKQDEAGHWISTFYMLKWL
LEHCYSVHHSLGRASGVVLTSLQWTLMTYVCDILKPFEEATQKVSVKTIGLNQVLPLIHHLLLSLQKLREDFQVRGITQALNLVDSLSLKLETDTLLSAMLKSKPCILAT
LLDPCFKNSLGDFFPQGADLETYKQILAEEVCNYMESSPEVSHIATSEGSGPSAIVGADSFTSSIREGTSISGSVDCSAADNVAIGGKSFMFPSAMAVVDEYFKEKYSEI
SGGDDPLFYWQKKVNIWPALTQVAIQYLSCPMCSWQSECVFTANSHFHPKQIMSLDFDNIEQLMFLKMNLKNVNYDYSALVLSWDPENEVIQSNEKEILP*
9 >lcl|XP_002701002.1|Plus12187591..2187956 NW_001493064 replication protein A2, 32kDa-like LOC100297777 __SEG__ Chr12 {Bos taurus} MDLYEFTTHILEVVNAHKMLSKSNSQPSAGKAPISNPGMGEAGDFSGNNFIPANGLTVAENQVLNLIKACLRPEGLNFQDLKNQLQHMSVASVKLAVDFLSNEGHIYSTV
DDDHFKSTDAE*
10 >lcl|XP_002704509.1|Plus11440859..1442154 NW_001495105 testis-specific Y-encoded-like protein 1-like LOC100336013 __SEG__ Chr5 {Bos taurus} MSSPDGGERTPLLETHSLATSDCAAGAPDPSRCLKTEASQVMAETGEGYFEAVTLPPPQLPEEEDAPPAAPPDPGCASTFQIRAGGDGGYVAPEARLEPAPPTEGLEMAS
GSLATDNSLGNGRQPGEPLGLSQEKPLETCGAENLGSDLMAEAKAEEVKTQDGPVFSVAVDEEVVGKEGAKEEEAMEQGMEVEERPVGEEIEIVENRVVEEAGHRPLRMD
LHMNPLEAIQLELDTVNAQADRAFQQLEHKFGWMHRHYLERRNYIIQNIPGFWVTAFRNHPQLSPMIRGQDAEMLRYITNLEVKELRHPRTGCKFKFFFRRNPYFRNQLI
VKEYEVRASGRVVSLSTPIIWRRGHEPQSFIRRNQEVVCNFFTWFSDHSLPESDRIAEIIKEDLWPDPLQYYLLREGVRRARRRPVREPVEIPRPFGFQSG*
11 >lcl|XP_603100.2|Plus1complement(4514166..4515449) NW_001493278 lysine (K)-specific demethylase 4C-like JMJD2D __SEG__ Chr15 {Bos taurus} MQAKHFGSQNPSCKIMTFHPTMEEYADFNKYIAYIESQGAHRAGLAKIVPPKEWKARQTYDDIDDILIAAPLQQVVSGRAGVFTQYHKKKKAMTVAEYRHLANTEKYQTP
FYSDFEELERKYWKTRLFESPIYGADISGSLFDENTKQWNLGRLGTIQDLLEQECGVVIEGVNTPYLYFGMWKTAFAWHTEDMDLYSINFLHFGEPKTWYAVPPEHGRRL
ERLAGALFPGSSRGCEAFLRHKAALISPTVLRDNGIPFGRVTQEAGEFMVTFPYGYHSGFNHGFNCAEAINFATPRWIDYGKVASQCSCGEAQVAFSMDAFVRILQPERY
ELWKRGQDRAVVNHAEPAAPGGQELSAWREVHSPWGTRLACNSQEPRQTPPRTPGPSPPDHHPTGRCVSRRRRPRKRGTPELTVRPGRRGASPKTQI*
12 >lcl|XP_873038.2|Plus13314702..3315943 NW_001493251 TSPY-like 5-like TSPYL5 __SEG__ Chr14 {Bos taurus} MSGRSKGRRSSRAKGRGKSRAKGRVRAAPDDAPRDPDPPECQRLGEETKAAQVQAGAVWGGPEGAAPAPPRRPGEEAACRLPLDCGLALRARAAGTRGQAVTRPCLVKAT
SFPERLVSDTVFVGTVGTVARPRNGPRVGSRRGPAAKKAPDTCSAVGRGSAALAGGKPKKGPAAEAASVPVGEEKVENAGSGPPATEGSMDTLENVQLKLETMNAQADRA
YLRLSRKFGQLRLHHLERRNLLIQNIPGFWGQAFQNHPQLSSFLNNQDKEVLSFLNSLEVEELGLARLGYKIKFYFGRNPYFQNKVLIKEYGCGPSGQVVSRSTPIQWLP
GHDLQTLSQGNPDNSRSFFGWFSNHSSIESDKIVEIINEELWPNPLQYYLMSEGARAEKGKEGRPGPARPPGETPEPGVNKSN*
13 >lcl|XP_875399.2|Plus1complement(4523861..4525363) NW_001493278 jumonji domain containing 2D JMJD2D __SEG__ Chr15 {Bos taurus} MEAMKPSCAQNPSCSIMIFHPTKEEFTDFDKYIAYIESQGAHRAGLAKIVPPKEWKARQTYDDINDILITAPLQQVVSGRAGVFTQYHKKKKAMTVAEYRHLANTEKYQT
PFYSDFEELERKYWKTRLFESPIYGADISGSLFDENTKQWNLGRLGTIQDLLEQECGVVIEGVNTPYLYFGMWKTAFAWHTEDMDLYSINFLHFGEPKTWYAVPPEHGRR
LERLAGALFPGSSRSCEAFLRHKAALISPTVLRDNGIPFGRVTQEAGEFMVTFPYGYHSGFNHGFNCAEAINFATPRWIDYGKVASQCSCGEAQVAFSMDAFVRILQPER
YELWKRGQDRAVVNHAEPAAPGGQELRAWKEVQTLGPKYFPPRRSARLRQPVSSSEGTDPRAPVRAVSLRPLPARGSCSASQFDAVAGSSSRKPSQTPPLLPGPSVASCL
HPVGRCGSRRRPQEKGTQELTAPIGAKRGLALDRKAQDPKAQPLSAEGRMDNPAPTSPGL*