SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr K    

ID / Description / Sequence
1 >lcl|NP_001008687.1|Plus1324692..325465 NW_003536620 major prion protein precursor PRNP __SEG__ Chr17 {Sus scrofa} MVKSHIGGWILVLFVAAWSDIGLCKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGGSHGQWNKPSKPK
TNMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGSDYEDRYYRENMYRYPNQVYYRPVDQYSNQNSFVHDCVNITVKQHTVTTTTKGENFTETDVKMIERVVEQMCIT
QYQKEYEAYAQRGASVILFSSPPVILLISFLLFLIVG*
2 >lcl|NP_001038080.1|Plus1897515..898216 NW_003536582 mediator of RNA polymerase II transcription subunit 7 MED7 __SEG__ Chr16 {Sus scrofa} MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLE
DLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKAEPMDADDSNNCTGQSDQQRENSGHRRDQIIEKDA
ALCVLIDEMNERP*
3 >lcl|NP_001116669.1|Plus1124623..125582 NW_003301137 transcription factor SOX-2 SOX2 __SEG__ Chr13 {Sus scrofa} MYNMMETELKPPGPQQTSGGGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDY
KYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHSAAQMQPMHRYDVSALQYNSMTSSQTYMN
GSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM*
4 >lcl|NP_001127823.2|Plus1296499..296672 NW_003534284 Krueppel-like factor 2 KLF2 __SEG__ Chr2 {Sus scrofa} EKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM*
5 >lcl|NP_001136308.1|Plus1complement(129763..129948) NW_003536224 X-box binding protein 1 pseudogene 1 XBP1P1 __SEG__ Chr14 {Sus scrofa} LISSWAFCSTWTQSCSSDVLPQTLPAWSSSQKSTQKDPVPYQPPLLHHWGRHQPSWKPLMK*
6 >lcl|NP_001138602.1|Plus1complement(366033..366842) NW_003535165 zinc finger protein 389 ZNF389 __SEG__ Chr7 {Sus scrofa} MDPRQKVSNIYNGNTLQIPGYEKASQYEDQLERHEDRPAEERRYKCTECGKKFAQSSGLVRHRRIHTGEKPYECDHCGKAFSVRSTLTVHERIHTGEKPYTCNECRKAFS
VRAHLIIHQRIHNGEKPYECNECGKAFSVSSDLIKHQRIHSGEKPYECDECGKAFSVSSALIKHQRIHTGEKPYECKECGKAFYVNSALINHQRIHSGEKPYKCGECRKA
FSQISTLIHHQRIHTGEKPYECDECGKAFRGSSNLTKHQKIHAKGKCHQ*
7 >lcl|NP_001177112.1|Plus1complement(505022..506149) NW_003534696 protein arginine N-methyltransferase 6 PRMT6 __SEG__ Chr4 {Sus scrofa} MSQPKKRKLESGGGGEGGEGTEEEDGGEQEAALPRPRRTRRERDQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYA
VEASDIWQQAREVVRLNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFVAPICDQMLELRLSFWSQMKQLYGVDMS
CLESFATRCLMGHSEIVVQGLSGEDVLARPQCFAQLDLARAGLEQELEAGVGGRFRFSSYGSAHMHGFAIWFQVTFPSGDWRNPLVLSTSPFHPVTHWKQALSXPERARA
SGARYGRFRRDYAPALPGQPPSPARAAALQSGRPGGKDQRLCHGGL
8 >lcl|NP_001182302.1|Plus1complement(296088..299672) NW_003301101 zinc finger and BTB domain-containing protein 38 ZBTB38 __SEG__ Chr13 {Sus scrofa} MSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNVLAASSLYFKNIFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETVTDLAAAGKK
LGISFLEDLTDRNFSNSPGPYVFCITEKGVVKEEKNEKRHEEPAITNGPRITNAFSIIETENSNNMFSPLDLRASFKKVSDSMRTTSLCLERTDVCHEVEPVRTLAEHSY
AVSSMAEAYRSQPVREQDSGSPEKTGTENCEAVAAKPKTSRKPKTPSVSQDSDSTPENISPPPASNLEVNQEESPQPVAILSRSKSPNNNEGEVRFPREDENKSSEVPGP
PATEVPPLVYNCSCCSKSFDSSTLLSAHMQLHKPTQEPLVCKYCNKQFSTLNRLDRHEQICMRSSHMPVPGGNQRFLENYPTIGQNGSSFTGPESLLSENRMGEFSSPGS
TLPETDHMVKFVNGQMLYSCVVCKRSYVTLSSLRRHANVHSWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCIFCLETFMTYYILKNHQKSFHAIDHRLSISKKTA
NGGLKPSVYPYKLYRLLPMKCKRAPYKSYRHSSYENTRENSQMNESAPGPYVIQNPHGSELPTLNFQDSVSTLTNSPAIPLETPARQDLPTPASVQNTEGTKWGERGELK
VDLDSRFYSAEMSVPSTENTSSSDHRAGEAPTLSASNGSENSASVISYSGSAPSVIVHSSQFSSVIMHSNAITPEMGHKPRAPLDLAVSQTPKEDGRPEPDKMGRGVNRP
KSGKEKKKTIPCNRGEIPEEPRYVADPGGSLSKTTNIMKETSKIETYIAKPALPGTSTNSNVAPLCQITVKIGNEAIVKRHILGSKLFYKRGRRSKYQVQEETLPQESDQ
ETNRASPLGLCQAECMEMSEMFDDASDQDSTDKPWRPYYNYKPKKKSRQLRKMRKANWRKEHENRSPSGKCKYPAELDCAVGKAPQEKPLEEEENKEMPKLQCELCDGDK
ASGAGNPGRPHRHLTARPYACELCAKPFQSPSTLKMHMRCHTGEKPYQCKTCGRCFSVQGNLQKHMRIHLGVKEFVCQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQ
SFLYLSTKRNHEQRHVQEHNGKGYACFQCPKICKTAAALGMHQKKHLFKSPSQREKTEGDVGQENSHPLENPHFLDSEDSDQKDNVQTLADNVL*
9 >lcl|NP_001186818.1|Plus1complement(167714..168754) NW_003536671 CCAAT/enhancer-binding protein beta CEBPB __SEG__ Chr17 {Sus scrofa} MQRLVAWDPACLPLPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASS
GQHHDFLSDLFSDDYGGKNCKKAAEYGYVSLGRLGAAKNALHPGCFAPLHPPPPPPPPQPAELKAEPGFEPADCKRKEEAGAPGGGAAGMAAGFPYALRAYLGYQAVPSG
SSGSLSTSSSSSPPGTPSPADAKAPPAACYAGAAPAPSQVKSKTKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRN
LFKQLPEPLLASSGHC*
10 >lcl|NP_999045.1|Plus1100077..101084 NW_003300193 transcription factor AP-1 C-JUN __SEG__ Chr6 {Sus scrofa} MTAKMETTFYDDALNASFLQSESGAYGYSTPKILKQSMTLNLADPVGNLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGF
AEGFVRALAELHSQNTLPSVTSAAQPVSGAGLVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQQPPQPPHHLPQQIP
VQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQ
QLQTF*
11 >lcl|NP_999617.1|Plus1complement(218049..218675) NW_003536874 sex-determining region Y protein SRY __SEG__ ChrY {Sus scrofa} MVQSYASAMFRVLKADDYSPAAQQQNILALGKGSSLFPTDNHSSKDGRETRGSGRESGQDRVKRPMNAFIVWSRDQRRKVALENPQMQNSEISKWLGCKWKMLTEAEKRP
FFEEAQRLQAVHRDKYPGYKYRPRRKGERAQNLLPAEAAVLCSQVRVEERMYPFTYTVAKAKCSGTESQLSHSQPMNITSSLLQQEDRCNWTGLCHSRV
12 >lcl|XP_001925193.2|Plus1133485..134777 NW_003534125 forkhead box protein B2-like LOC100156565 __SEG__ Chr1 {Sus scrofa} MPRPGKSSYSDQKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPDCGDMFENGSFLRRRKRFK
VLRTDHTHLHAGSTKGTPGTGPGGHLHPHHPHHPHHHHHHHHATAHHHHHHHPPQPPPPPPPPHMVHYFHQQPPPAPQPPPHLASQPPQQPPQQSQPQQPSHSGKMQEAA
AVAAAAAAAAAAAVGSVGRLSQFPPYGLGSAAAAAAAAAASTSGFKHPFAIENIIGRDYKGVLQAGGLPLASVMHHLGYPVPGQLGNVVSSVWPHVGVMDSVAAAAAAAA
AGVPMGPEYGAFGVPVKALCHSASQSLPAVPVPIKPTPGLPPVAAQPPTLTVPTAAQQPPAPSTVCPAAAASPAASLMEATAPSASESKSGSLHSVLVHS*
13 >lcl|XP_001925221.2|Plus1472520..473329 NW_003301213 oligodendrocyte transcription factor 1-like LOC100156451 __SEG__ Chr13 {Sus scrofa} MYYAVSQARVNAAPATMLRAQRPGDVQLGTSLYELVGYRQPPSSSSSSSTSSSTTGPLLPKAAREKLEAPAEPPGTGSGPGAHTGGSSRADAKEEQQQQLRRKINSRERK
RMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDE
PPCGQFALPGGGPGGGAGSPGLCTCAVCKFPHLVPAGLGLAAVQAQFSK*
14 >lcl|XP_001925267.1|Plus11011243..1012364 NW_003534140 forkhead box protein E1-like LOC100157892 __SEG__ Chr1 {Sus scrofa} MTAESGPPPPPPQQSEALAAVKQERGEAGAGVPAEAAGRGAGGRRRKRPLQRGKPPYSYIALIAMAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLND
CFLKIPREAGRPGKGNYWALDPNAEDMFESGSFLRRRKRFKRSDLSTYPAYMHDAAAAAAAAAAAAAAAIFPGAVPAARPPYPGAVYASYAPPSLAAPPPVYYPAASPGP
CRVFGLVPERPLSPELGPSPSGPVGSCAFASAGASAATTGYQPTGCAGARPANPSAYAAAYAGPDGAYPQGASSALFAATGRLAGPSSPPAGGSSGGVETAVDFYGRTSP
GQFGALAPCYNPAGQLGTGSGGTYHARHAAAYPSGVDRFVSAM*
15 >lcl|XP_001925585.1|Plus11782881..1783567 NW_003535158 hepatoma-derived growth factor-like protein 1-like LOC100156270 __SEG__ Chr7 {Sus scrofa} MSRFCRRKYKNGDLVFAKLKGYAHWPARIEQTAEANRYQVFFFGTHETAFLGPKHLFPYEECKEKFGKPNKRRGFSEGLWEIENNPTVQASDYQFAQKSGTEELEPEATE
GFEDLKSLTDGSGGTKQGRRGLDPPALQKKERLKRSAGDPPEGIPKRPREANPEAGKEMEEAAAAEDARPPLPEAEINHAVTQWGPTWEPPVEEEWEWEEEAAEREAEAA
GFGRPESQ*
16 >lcl|XP_001925801.1|Plus1145020..146105 NW_003536809 POU domain, class 3, transcription factor 4 POU3F4 __SEG__ ChrX {Sus scrofa} MATAASNPYSILSSSSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATGPLEQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNH
PNAWGTSPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPASASSQSLHPVLREPPDHGDLGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALG
TLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRR
QKEKRMTPPGDQQPHEVYSHTVKTDTSCHDL*
17 >lcl|XP_001925963.1|Plus1440828..441598 NW_003534651 CCAAT/enhancer-binding protein delta-like LOC100153946 __SEG__ Chr4 {Sus scrofa} MSAALFSLDGPARGAPWSAEPAAFYEPGRAGKPGRGTEPAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGALELLPGAPARPAGPGPAPRPLKRE
PDWGDGDAPGSLLPAQVAACAQTVVSLAAAAQPTPPASPEPPRRSPAPPAPGPARDKAAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKL
QQRVEQLTRDLAGLRRFFKQLPGAPFLPGAGAADAR*
18 >lcl|XP_001926148.2|Plus1complement(438953..441148) NW_003301631 ribosome-binding protein 1 RRBP1 __SEG__ Chr17 {Sus scrofa} MDIYDTQTLGVVVFGGFMVVSAIGIFLVSTFSMKETSYEEALANQRKEMAKTHHQKVEKKKKEKTVEKKGKTKKKEEKPNGKIPDHEPAPDVTILRKDPVHTPAVAVAPT
PVQSPVIIAPVATVPAMPQEKPASSPKDKKKKEKKVAKVEPAVSSVVNSVQVLTSKAAILEAAPKEVPMVVVSPVGAKGSAPATSTAQGKKAEGSQNQGKKVEGSPSQGR
KAEGIPNQGKKGEGASNQGKKGEGTPNQGKKGEGTPNQGKKGEGTPNQGKKGEGAPNQGKKGEGAPNQGKKAEGTPNQGKKAEGAPSQGKKAEGTPNQGKKAEGAPSQGK
KAEGAQNQGKKSEGTPNQGKKAEGAPNQSKKSEGTPNQSKKAEGAQNQGKKAEGAQNQGKKEAGTPNQGKKVEGSPNQGKKVEVAQNQSKKAEGAPNQSKKTEGAQNQGK
KSEGAQNQGKKAEGAPNQGKKAEGAPNQGKKAEGTQNQGKKAEGAPSQGKKAEGAPNQGKKAEGAQNQGKKAEGVPNQGKKAEGSQNQGKKAEGSSNQGKKGEGTPNQGK
KAEGTQNQGKKTEGSSNQGKKGEGTPNQGKKAEGAQNQGKKAEGSSNQGKKAEGAQNQGKKAEGSSNQGKKADGGQNQGKKADSVANQGTKVENVANQGKKAEGASNQGK
KAEGALNQGKKSEGSPNQGKKADTSANQGKKAESAPIQGENADMIQNQEAPKQEAPAKKRSRSKKKGEPGK*
19 >lcl|XP_001926276.1|Plus1625475..626803 NW_001886145 POU domain, class 3, transcription factor 2 POU3F2 __SEG__ Chr1 {Sus scrofa} MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYAALQSNGHPLSHAHQWITALSHGGGGGGGGGGGGGGGGGGGGGDSSPWSTSPLGQPDIKPSVVVQ
QGGRGDELHGPGALQQQHQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPSMGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDE
PHHTDHHPHPHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKW
LEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTP
VQ*
20 >lcl|XP_001926635.1|Plus1695902..696534 NW_003536196 methyl-CpG-binding domain protein 3-like 1-like LOC100157664 __SEG__ Chr14 {Sus scrofa} MMKTSQRKHRDGGKQGKPEPSLNISIPLRLSSYIFKRPVTRITPHPGNEVRCHHWEETLDSPQQLYWHKRLQGLQACSSTGELLSPLDLAKALQKLAPRCTDESLLGLPA
GDPNSGPVATPARSTDLPETISGASLDRPQLHCRRCLVTEEDIRNQERNVKTARERLAIALTADRLAGEAEKARGQEGHPDKHCGKEVRMVQMKLHTMLY*
21 >lcl|XP_001926826.2|Plus11418014..1418259 NW_003534759 DNA-directed RNA polymerases I, II, and III subunit RPABC5-like LOC100156985 __SEG__ Chr5 {Sus scrofa} MGIRSLAAGRFAATMTIPVHCFMCGKIVSNTWEAYLGLLQAKYTEEDALDALGLKQYCCRHMLLAYMDLIEKLLNYAPLEK*
22 >lcl|XP_001926840.2|Plus1932402..933748 NW_003536227 zinc finger protein 70-like LOC100157520 __SEG__ Chr14 {Sus scrofa} MELPPAAKLGEAFVFEDGLEMQPNLFSDEDLGDSFLQERGLEQMAVIYKEIPLGEQDEEPNDYEGNFSLCSSPVQHQSLPPGDRPPDEELFGQTFLQKPELSMCQIIHGA
EESGKPNGQTVGSGDPGPEGPHGTVQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQVIHTGEKPYECRECGKAFRQSSALTQHQKTHT
GKRPYECRECGKDFSRSSSLRKHERIHTGEKPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECELCGKAFCHRSHLIRHQRIHSGKKPYTCEECGKAFSQSSNLLEHRKT
HTGEKPYKCHKCGKAFSQSSSLIEHQRTHTGEKPYECGQCGKAFCHSSALIQHQRIHTGRKPYACNECGKAFRHRSALIEHYKTHTREKPYECNRCGKAFRGSSHLIRHQ
KTHTAEKR*
23 >lcl|XP_001926891.1|Plus128194..28979 NW_003536210 zinc finger protein 664-like LOC100156972 __SEG__ Chr14 {Sus scrofa} MIYKCPMCREFFSERADLFMHQKIHTAEKPHKCDKCDKGFFHISELHIHWRDHTGEKVYKCDDCGKDFSTTTKLNRHKKIHTVEKPYKCYECGKAFNWSSHLQIHMRVHT
GEKPYVCSECGRGFSNSSNLCMHQRVHTGEKPFKCEECGKAFRHTSSLCMHQRVHTGEKPYKCYECGKAFSQSSSLCIHQRVHTGEKPYRCCGCGKAFSQSSSLCIHQRV
HTGEKPFKCDECGKAFSQSTSLCIHQRVHTKERNHLKISVI*
24 >lcl|XP_001926960.2|Plus1complement(210847..211926) NW_003535163 zinc finger protein 391-like LOC100155322 __SEG__ Chr7 {Sus scrofa} MESLQGSSTQRSMNEDAGKSEGQLSRQTKCSTIQKKSSFEKTAIRKVSMTLKEIFTRERGSESSDFSLSSKLKTQQKIPKEARSPIPRKNSKDKSDLIKHQKTFPQRKPC
KHSECGKAFNYQSDLTVHSGNHGGEKPFECNECGKTFSRSTHLIEHQRTHTGEKPYECSECGKAFSRSTHLSLHRRIHTGEKPYECRECGKAFSRSTNLSQHQRTHTREK
PYKCNECGKAFSDRSTIIQHQRIHTGENPYECSECGKAFSWISSLIEHQRTHTGENPYECSDCGKVFSRSSSLVEHQRIHTGERPHECRECGKGFSRSSSLIIHQRTHTG
EKPYKCNNCGKSFSQSSTLIRHQQLHTKE*
25 >lcl|XP_001927064.1|Plus1114446..115330 NW_003536609 zinc finger protein 42 homolog ZFP42 __SEG__ Chr17 {Sus scrofa} MDQQLKKREKKGLGGRAVSREQSQAAQQEPPDEAWTLSDEDVCYETSFRVVEEDSFSDCYIECIIRGEFSEPLVEEDSLLKSLDCLKEGSEQELSQQVLTASSLLDCSLE
YMKKGAKQELPQPSVGENSLLEFSEYVPGKKLPPGKIPSTDFSDPEALTECARTKPSKNKSAPEKIVCPESGCTREFISRASLRKHLSVHSPRDHVCAECGKAFKESAKL
KRHFLVHTGEKPFPCTFEGCGKRFSLSFNLRTHVRIHTGEKPFVCPFEGCRRKFIQSNNMKSHLLTHTKANTNQ*
26 >lcl|XP_001928110.1|Plus1complement(2964803..2966212) NW_003536215 zinc finger and SCAN domain-containing protein 21-like LOC100157987 __SEG__ Chr14 {Sus scrofa} MMTKVLGMATVLGPTPPQEQGPVIVKVEEEEKGKRLEMFRQRFRQFGYHDTPGPREALSQLRVLCCEWLRPEIHTKEQILELLVLEQFLTILPQELQAWVQEHCPESAEE
AVTLLEDLERELDEPAQQASPPPREQSQSWETMSSGTTKESLSSPQPQALKTGHQYESWGPLYIQETGEEQGFTPELRKIQDHKSNTQHEETTDKQEGSKESHAEEFRRD
TVPMIIASKCEARLERQRVNLEKERGTKTPLQGKGSPKRRELITKPAPGERRYICAECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYD
CKCGKAFGQSSDLLKHQRMHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQRLHTGEKPYKCTECGKAFNHSSNFNKHHRIHTGEKPY
WCSNCGKTFCSKSNLSKHQRVHTAEREGP*
27 >lcl|XP_001928280.1|Plus1889910..890905 NW_003534749 neurogenic differentiation factor 4-like LOC100151884 __SEG__ Chr5 {Sus scrofa} MAKTYVKPKEMTELVNTPSWMDKGLGSQKEMKEEERRPAAYGMLGSLAEEHDSIEEEEEEEEDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNL
RRVMPCYSKTQKLSKIETLRLARNYIWALSEVLETGQTPEGKGFVEMLCKGLSQPTSNLVAGCLQLGSQSVLLEKHEEKSPLCDSTISVHNFNYQSPGLPSPPYGHMETH
LINLKPPVFKSLGESSFGSHPPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYSFIPHYPSASLSSGHMHSTPFQAGTPRYDVPIDMSYDSYPHHGMGAQLNTIFT
D*
28 >lcl|XP_001928671.1|Plus1620094..620912 NW_003299190 oligodendrocyte transcription factor 3-like LOC100153431 __SEG__ Chr1 {Sus scrofa} MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMVQKMPGESLSRAGAKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVM
PYAHGPSVRKLSKIATLLLARNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANAVHPVHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPS
TPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK*
29 >lcl|XP_001928905.1|Plus1complement(544463..545851) NW_003536156 nuclear factor interleukin-3-regulated protein isoform 1 NFIL3 __SEG__ Chr14 {Sus scrofa} MQLRKMQSIKKEQASLDAGSSMDKMMVLNSALSEVAEDLTTGEELLLNEGSVGKNKSSACRRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGE
ENATLKAELLSLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKSTVSAFVDEPEPSMVASSCISVIKHSPQSSLSDVSEVSSLEHSHEGPAQGGCRSPESKFQVIKQ
EPMELESYAREPRDDRGTCRAAVYQNYMGNSFPGYSHSPPLLQVNRSSSNSPRTSETDDGTVGKSSDGEDEQQVPKGPIHSPVELQRVHATVVKVPEVNSSALPHKLRIK
AKAMQIKVEAFDHEFDGTQKLSSPVDMTSKRHFELEKHNASNLVHSSLTPFSVQVSNIQDWSLKSEHWHQKELSGKTQNSFKTGVVEVKDNGYKVSDPENLFLKQGIANL
SAEVVSFKRLIATHQISASDSG*
30 >lcl|XP_001929557.1|Plus1620745..621152 NW_003299879 helix-loop-helix protein 2-like LOC100152544 __SEG__ Chr4 {Sus scrofa} MMLSPDQAADSDHPSSAHSDPESLGGADAKVLGSVSDLEQVEEAEGDGKGGGRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPD
KKLSKIEILRLAICYISYLNHVLDV*
31 >lcl|XP_003121680.2|Plus1891938..894052 NW_003534020 LOW QUALITY PROTEIN: zinc finger protein 770-like LOC100514616 __SEG__ Chr1 {Sus scrofa} MMAENNFKMLKIQQCVVANKLPRNRPYICNICFKHFETPSKLARHYLIHTGQKPFECDVCHKTFRQLVHLERHQLTHNLPFKCSICQHHFKNLKTFVKHQQLHNETYQND
VKQVRRLLDAKQEKPVYGMYHSFTTEERWALHPHSKSDPTYSPTKKKKNIHACTICGKMFPSQSKLDRHALIHTGQRPFKCVLCNKSFRQSTHLKIHQLTHSEDRPFQCC
FCQKGFKIQSKLLKHKQIHTRNKSFPTLSLNVKSAESCPLPNKLNAKQDGSENGDIGETEENNQLDVHSIYIVPFQCPECEECFESEQILKGHKCFPARSGKIPSRLKRS
YNYKTIVKKILAKFKHAGGKKFDNFRSEKKIFKNSFLKKCDLISDEQSSEQTQKTFMGSLGKRGTYKTAVNKRKKTLALPFSWQKHFQSQNMGKNFKGILTPENVLTMDN
SVINKDISTYGSSGEEFFDNCEVLQCGFSVPSENIHTGHKICPCDKCEKVFPSVSKLQRHYLIHTGQRPFDCNVCGKSFRQSAHLKRHKLTHIDKIPYRKSLCQVEFVQE
NLNKLFVHQGDNVNYNASQQCQTLGFQKYEVSESDQISEVKAESEDFIVGPPYRNRQPYLSSVLLESEQSCHNHCCSYSGRTERNDGLLYQCSVCSKSFRSPSKLERHYL
IHAGQKPFECSVCGKTFRQAPHWKRHQLTHFKE*SQEKMVDLVL*
32 >lcl|XP_003121788.2|Plus11456877..1457410 NW_003534056 mothers against decapentaplegic homolog 6-like LOC100516659 __SEG__ Chr1 {Sus scrofa} MSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKV
PPGYSIKVFDFERSGLLQHGPEPDAADGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEILLNNHR*
33 >lcl|XP_003122201.1|Plus1328344..329666 NW_003534168 zinc finger and BTB domain-containing protein 26-like LOC100511061 __SEG__ Chr1 {Sus scrofa} MSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDIEVQGHKIVFAAGSPFLRDQFLLNDSREVKISILQSSEVGRQLLLSCYSGVLEFPEMELVNYLTAASFL
QMSHIVERCTQALWKFIKPKQPMDSKEGCEPQSASPQSKEHQGDARGSPKQNSPCIHPSEDSMDMEDSDIQIVKVESIGDVSEVRSKKDQNQFISSEPTALHSSEPQHSL
INSTVENRVSEIEQNHLHNYALSYTGSDIIMASKDVFGPNIRGVDKGLQWHHQCPKCTRVFRHLENYANHLKMHKLFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKIC
GKTFSQKCSLQDHLNLHSGDKPHKCNYCDMVFAHKPVLRKHLKQLHGKNSFDNANERNVQDLTVDFDSFACTTVTDSKGCQPQPDATQVMDAGKLAQAVLNLRNDITCVN
*
34 >lcl|XP_003122311.2|Plus1814937..815572 NW_003534183 hypothetical protein LOC100513777 LOC100513777 __SEG__ Chr1 {Sus scrofa} MAAAADAGQGGAVSVDLRHERRMVCVEYPGLVRDVSKMLLTLGGEESVSRVRSVESPGSTGADHRGTTARGAGPPRDARFPWQWSLRLALQRPAGGDLLLRPLGVDRFFL
AGRGRGKRTIGRRREGLPSSDEPQLWHFCLELSSAAAPRFLPPQDVLDCHILISRSRKLRYGKLGTVDLSEREEGRIMLFRLKVVKANNLLCTSYSSKCFT*
35 >lcl|XP_003123186.2|Plus1complement(114176..114754) NW_003534271 putative methyl-CpG-binding domain protein 3-like 5-like LOC100522241 __SEG__ Chr2 {Sus scrofa} MPQALEEKRQVHLARTKQRHRDRSGLPLRLTSCIFKRPVTKTTAHPGNKVRRSQQEETLKKPQQVCAFRRLQGLQACSPEGDLFSTLDSAKVVRDIAPGGAVESNSLAGA
RSLHPSTKAIPAQSSDGAEMIPGLGLFLPESLCKQPVITYGHIRRQAQKVKKARERLAMALRADKLAREAERARGLGNLGVS*
36 >lcl|XP_003123645.1|Plus1313579..314973 NW_003299538 zinc finger protein 672 isoform 1 ZNF672 __SEG__ Chr2 {Sus scrofa} MFAASEAGVGRPYTCSECGKSFRYSSVLLRHERAHGSDSHLRCLECGEHCAQAADLRSHRRVHAGQTLYICSECGQSFRHSGRLDLHQSVHRRRGRSCRCRTCGRCFPHL
PALLLHRRHWHPPERPCRCPLCPRAFRQSALRFHQARAHPWGIPAVPTDTLHHCTQCSRVFCSGVGLRRHLRVHVARSPGDSTLQQPATLDAHQCGVCGKSFAKSSTLTR
HLQAHSGEKPFKCPECGKGFLESATLVRHQRTHTGEKPYACGDCGRRFSESSTLLRHRRSHQGERPHACATCGKGFGQRSDLIVHQRIHTGERPFPCTECGRCFSDRSDL
TKHWRTHTGEKPYRCELCGKRFTCVSNLNVHLRNHAGHKPHKCPECGKAFSVSSKLALHRKTHLGERPAECAECGKCFSHSRSLSQHQRAHTRARAATTAATATQDKAST
ALIFAEQARQEKLGFSVPKFKETC*
37 >lcl|XP_003124106.1|Plus1complement(150817..151866) NW_003534376 transcription initiation factor TFIID subunit 7 TAF7 __SEG__ Chr2 {Sus scrofa} MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEP
AATADPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKETENQGLDISSPGMSGHRQGHDSLEHDELR
EIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKED
REKEQLSSLQEELESLLEK*
38 >lcl|XP_003125344.1|Plus164118..65311 NW_003534536 uncharacterized protein C2orf53 homolog isoform 1 LOC100522547 __SEG__ Chr3 {Sus scrofa} MLPQNKDQVLLQKAASPGHPPQRPSQLVDSLPCNLQPQPPQRSLRPGHPPCSPPLRSHSAGSHFYSSDSNSDSVLHPYSCSLPSSPTFFHQNYPSLSLPCSSSPSRLYPS
PTLTHSSSPSQPPNSLPGSHCRSPSQPEDLPSSTLTCWSPSLPSRGVLSNSQTWPSHQYRDTRSRGVEGGCVASERDPAEFRDPGALAQVLVVHLGHRRIAHDLRLLLLQ
RLWLGRTGQAPVVEYPICLVCLRPRSPSCPSPRYRTGPRLLAFPQLLPCAPGQESGPLRIGIGFGLRLPRGQARALHLLPERRPEEVGSQGEAAQARGCQAQASQALAAQ
ARADLGPGTPSQPGSLRSVGPQSPNSMQFSGSPTQAPKQATVCLKPRPYSAPKRPASPEPIHGRSPP*
39 >lcl|XP_003125407.2|Plus1complement(53056..53700) NW_003534548 mesogenin-1-like LOC100520670 __SEG__ Chr3 {Sus scrofa} MANLRETFLSLEDGLGSSDSPGLLSSWDWKDRAGPFELNQASPTQSLSPAPSLESYSSSPCPAVARLPCGHGGANSGGGDDCGGLGTGGLVEVDYNMLAFQPAYLQGAGG
AKAQKGTKVRMSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTDLLNSGREPRPQSARAQPRHPGTHHSSPLGGAEEI*
40 >lcl|XP_003125713.1|Plus1complement(529274..529675) NW_003299865 helix-loop-helix protein 1-like LOC100512227 __SEG__ Chr4 {Sus scrofa} MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGLEPGEPGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKK
LSKIEILRLAICYISYLNHVLDV*
41 >lcl|XP_003126125.1|Plus1complement(335647..336168) NW_003534734 achaete-scute homolog 4-like LOC100520021 __SEG__ Chr5 {Sus scrofa} MMEKRKPAGLLTLPYHLRPVPVGVPGSLLRLPLRDPFRVSWSLDAVRWERTHGGCAPRRPYLPLPLDGAFEPAFLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLS
KVETLRAAICYIKHLQELLERHARGQEGAADAAPPRRAECNSDGESKASSAPSPSSEPEEGAS*
42 >lcl|XP_003126309.1|Plus1complement(291570..292877) NW_003534753 zinc finger CCCH domain-containing protein 10-like LOC100519147 __SEG__ Chr5 {Sus scrofa} MPDRDSYANGTGSSGGGPGGGGSEEASGTGAGSGGASSDAICRDFLRNVCKRGKRCRYRHPDMSEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGE
LPPRLRQKVAAGLGLSPADLPNGKEEVPICRDFLKGDCQRGAKCKFRHLQRDFEFDARGGGGAGGGGSAGPVPPGRRHDLYDIYDLPDRGFEDHEPGPKRRRGGCCPPDG
PHFESYEYSLAPPRGVECRLLEEENAMLRKRVEELKKQVSNLLATNEVLLEQNAQFRNQAKVMTLSSTAPATEQTLAPTVGTVATFNHGIAQTHTTLSSQALQPRPVSQQ
ELVAPAGAPAAPPTNAAPPAAPPPPPPHLNPEITPLSAALAQTIAQGMAPPPVSMAPVAVSVAPVAPVAVSMAQPLAGITMSHTTTPMVTYPIASQSMRITAMPH*
43 >lcl|XP_003126317.1|Plus1complement(475240..476547) NW_003534753 zinc finger CCCH domain-containing protein 10-like LOC100521269 __SEG__ Chr5 {Sus scrofa} MPDRDSYANGTGSSGGGPGGGGSEEASGTGAGSGGASSDAICRDFLRNVCKRGKRCRYRHPDMSEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGE
LPPRLRQKVAAGLGLSPADLPNGKEEVPICRDFLKGDCQRGAKCKFRHLQRDFEFDARGGGGAGGGGSAGPVPPGRRHDLYDIYDLPDRGFEDHEPGPKRRRGGCCPPDG
PHFESYEYSLAPPRGVECRLLEEENAMLRKRVEELKKQVSNLLATNEVLLEQNAQFRNQAKVMTLSSTAPATEQTLAPTVGTVATFNHGIAQTHTTLSSQALQPRPVSQQ
ELVAPAGAPAAPPTNAAPPAAPPPPPPHLNPEITPLSAALAQTIAQGMAPPPVSMAPVAVSVAPVAPVAVSMAQPLAGITMSHTTTPMVTYPIASQSMRITAMPH*
44 >lcl|XP_003126437.1|Plus1957988..959154 NW_003534776 pleckstrin homology-like domain family A member 1-like LOC100523904 __SEG__ Chr5 {Sus scrofa} MRRTPAAERLSELGFPPRRGRQEPPFPLGVTRGWGGWSIQKRREGARPVPFSERLQEEGRGPAARSSGTLWRIRTRLPCCPDPEPPPPQPLCFLRVSLFCALRAGGRGSR
WGEDGARLLLLPPARAAGSREAEPIGGSPYAGRMLESSGCKALKEGVLEKRSDGLLQLWKKKCCILTEEGLLLIPPKQLQHQQQQQQQQQPGQGSVEPSQSGGPAVASLE
PPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQHLVQQQPPQPQLQPQAQPQPQPQPQPQSQAQPQL
QPRPQPQPKPQPQQIHPHPHPHPHPYPHPHSHPHPHAHQQPLSQPHGHRLLRSTSNSA*
45 >lcl|XP_003126776.1|Plus1401101..402321 NW_003534857 uncharacterized protein C12orf12 homolog LOC100521557 __SEG__ Chr5 {Sus scrofa} MTQTLDTREDPLNLGGGWSSSAPLRTWSSCHRRRRGAPIYKRRHHYGPKAEYEPPWKQQKQQHGPGPWFHPPRRPSWAVYSNWGRWGGPWRPPPARFRKPPGRVQVIRVY
GLHPLCLCCCSCWRGPWNPGWARPPGRKKRWGRRGRGLRRHSRRSFPRRPPVDLSTLLRPVNLYGWRAPGMRAPKNTTQFIMNQIYEDMRQQEKLERQQEALRAQQAQAG
GTAFPSGSFGNDAPPSGGEEDAAQQEPLYSFAQNPSLVFSPDPEEEDQSPPQLVEEEEGEEKNDDEEECDEEEGDGKELESEEEEEDEEAEAKDEEEMEEADYVQAGEEE
EEVEEEEEETEEEEEGLEEDEQREEENHLPLEMPLSILVGAEEEREKFINCTYLSPTQIIPKVPQEGLLMLQDINC*
46 >lcl|XP_003126859.1|Plus1complement(87875..88891) NW_003534879 forkhead box protein L1-like LOC100511634 __SEG__ Chr6 {Sus scrofa} MSHLFGPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAEPPQKPPYSYIALIAMAIQDAPGQRVTLSGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKV
PREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPGPGAPEAKRARGPAQPEAGSGAERPRPATPRHEGAPARPPPLRAGASPSAPLHGPRPSSPEGNAGDALRGAGA
EAAEQPARTADGRGSPPRPASGSSPKSSDKSKSFSIDSILAGRQGQKPAGGDELLGGPKPEPGGCLGASLLAASSSLCPPFNASLMLDPHVQGGFYQLGIPFLSYFPLQL
PDTVLHFQ*
47 >lcl|XP_003126973.1|Plus1117091..118020 NW_003300042 THAP domain-containing protein 11 THAP11 __SEG__ Chr6 {Sus scrofa} MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQ
QQQQQQQQQQQPPPPPQPSPSASTAQTGQLQPNLVSASAAVLLTLQAAVDSSQAPGSGQPAPTTPTGEDVKPIDLTVQVEFAAAEGAAAAAAASELEAATAGLEAAECPM
GPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRLLAMAVIRKKHGM*
48 >lcl|XP_003127063.1|Plus1complement(173142..174206) NW_003300070 CCAAT/enhancer-binding protein alpha CEBPA __SEG__ Chr6 {Sus scrofa} MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAAPAGGGGDFDYPGAP
VGPGGAVMPGGAHGPPPSYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDESKQLALAGLFPYQPPPPPPPPHSHPPPAHLAAPHLQFQIAHCGQTTMHLQPGH
PTPPPTPVPSPHPAPALGAAGLPGPGGALKGLAPAHPDLRAGGGGGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRE
LDTLRGIFRQLPESSLVKAMGNCA*
49 >lcl|XP_003127065.1|Plus1258124..258618 NW_003300070 CCAAT/enhancer-binding protein gamma-like LOC100525580 __SEG__ Chr6 {Sus scrofa} MSACSGLTRESAQMSRVSPQTSGAPPVLNGLTVTHTQAHASGLQQVPQLVPAGPGGGGKAAPPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVN
QLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQPSSTENTTNSDSAGQ*
50 >lcl|XP_003127222.1|Plus1complement(38227..40233) NW_003534955 zinc finger protein 526-like LOC100515382 __SEG__ Chr6 {Sus scrofa} MAEVAEVAEMPTQMSPGAMEMSTPMLGEKTERSAEVTEIAPGEALASSLFFQFMCSECGSLYNTLEEVLSHQEQHVPTVMEEEALTSQDTCLEPELVPGPEDGPFQCAEC
SQLILSPSELLAHQDAHLRESASQIQYQCGDCQELFPSPELWVAHRKAQHLSAAAVKPPVPPPLPPLTPPPPSPAPPEVKMEPYECPECSTLCTSPEEFLEHQGTHFDSL
EKEERNGLEEEEEEEEDDDEETEDEEEAAAEVGDNAMEGDKSVASQAQGCGDCPQHWTSAGARRRHRRTSRGPASAAHPFHCSQCQRSFSSANRLLAHGRAHVGGTHECT
TCSKVFKKAASLEQHLRLHRGEARYLCVDCGRGFGTELTLVAHRRAHTANPLHRCRCGKTFSNMTKFLYHRRTHAGKSGAPPGAAAAAVTSPAPAEPSPLPPPPAPPAQL
PCPQCSKSFATASRLSRHRRAVHGPPERRHRCGVCGKGFKKLVHVRNHLRTHTGERPFQCHSCGKTFASLANLSRHQLTHTGVRPYQCLDCGKRFTQSSNLQQHRRLHLR
PVAFARAPRLPITGLYNKSPYYCGTCGRWFRAMAGLRLHQRVHAQARTVTLQPPRSPPPAPPPPPEPQQTIMCTELGETIAIIETSQPLALVDTLQLCQAALGATEASGL
LQLDTAFV*
51 >lcl|XP_003127906.1|Plus1complement(263270..263692) NW_003535035 DNA-directed RNA polymerase II subunit RPB11-like LOC100525756 __SEG__ Chr6 {Sus scrofa} MHALPAFESFLLFKDEKITIHKDTKAPNACLFTIDKEDHTLGNVIKSQLLKDPQVLFAGCQVPHPWEHKIIVPVQTTPDYTPQEALLNVITDLISKLSLLEERLRVAIKD
KQEGIECWTGRGPAWPGPALTLALLQAPCG*
52 >lcl|XP_003128164.1|Plus17161..8138 NW_003300213 zinc finger protein 134 isoform 2 ZNF134 __SEG__ Chr6 {Sus scrofa} MEKLLREDKSKTSFVKNCRVCQEPHLLEKLFACKEEQKDFQDSLGSHQQKATHSKRKTRSTESGETFHIGQMDYKCSECGKAFSRKDTLVQHQRIHTGERPYECNECGKA
FSRKATLIQHQRIHTGERPYECSECGKAFSRKDNLTQHKRIHTGEMPYKCHECGKHFSHHSNLIVHQRVHNGARPYKCNNCGKVFRHKSTLVQHESIHTGENPYVCSDCG
KSFGHKYTLIKHQRIHTETRPFECVECGKFFSRSSDFIAHQRVHTGERPFVCSKCGKDFIRTSHLVRHQKVHTGERPYECNECGKSYSLSSHLIRHQKVHTAGRL*
53 >lcl|XP_003128178.1|Plus1complement(155907..157520) NW_003300215 zinc finger protein 329 ZNF329 __SEG__ Chr6 {Sus scrofa} MTAQDLPEELSCDMELEGFTRQGPHFSILDDSWNCESQEGCLKQSALTQEEPGAQKAVHEYPGFGEHLSVSPDLPRYQRVPTTNGFCVHGSDVKSLDCDPALHSCHKSYV
ARRTGDSDACGKTFSHSIEVIQFGRTQTREKPCKYPETVKSFSPFAPLGEQKIMKRGKKLYEGKDFGDIFTLSSSLNENKRSSPGEKLYKCTECGKCFKRNSSLVLHHRT
HTGEKPYTCNECGKSFSKNYNLIVHHRIHTGEKPYKCSKCGKAFSDGSALTQHQRIHTGEKPYECLECGKTFNRNSSLILHQRTHTGEKPYRCNECGKPFTDISHLTVHL
RIHTGEKPYECSKCGKAFRDGSYLTQHERTHTGEKPFECVECGKSFNRNSHLIVHQKIHSGEKPYECKECGKTFIESAYLIRHQRIHTGEKPYGCDQCQKLFRNIAGLIR
HQRTHTGEKPYECNQCGKSFRDSSCLTKHQRIHTKETPYQCPDCGKSFKQNSHLAVHQRLHSREGPSHCPQCGKTFRRSSSLIRHQRSHPGEQPVDL*
54 >lcl|XP_003128248.1|Plus1880690..882123 NW_003535158 transcription factor SOX-4-like LOC100512542 __SEG__ Chr7 {Sus scrofa} MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIR
EAERLRLKHMADYPDYKYRPRKKVKSGNANSSSSTAASSKPGEKGDKVGGSGGGGHGGGGGSSNAGGGGGGASGGGGANSKPAQKKSCGSKVAGGAGGGVGKPHAKLILA
GGGGGKTAAASSASLAAEQAGAAALLPLGAAAAADHHSLYKARTPGASASASAAASASTSLGAPGKHLTEKKVKRVYLFGGLGASSSPVGGVGAGADPSDPLGLYEEGGA
GCSPDGPSLSGRSSAASSPTAGRSPADHRSYASLRAASPAPSSAPSHASSSASSHSSSSSASSSSGSSSSDDEFEDDLLDLNPSSNFESMSLGSFSSSSALDRDLDFNFE
PGSGSHFEFPDYCTPEVSEMISGDWLESSISNLVFTY*
55 >lcl|XP_003129209.2|Plus11132978..1133775 NW_003535405 POU domain, class 4, transcription factor 2-like LOC100522504 __SEG__ Chr8 {Sus scrofa} MNTIPCTSSASSSSVPISHPSALAGTHHHHHHHHHHHHQPHQALEGELLEHLSPGLALGAMAGPDGAVVSTPAHAPHMATMNPMHQAALSMAHAHGLPSHMGCMSDVDAD
PRDLEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKSHREKLTKPELFNGAEKKRKRTSIAAPEKRSLEAYF
AIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAGI*
56 >lcl|XP_003129367.1|Plus1complement(79965..81026) NW_003535460 protein atonal homolog 1-like LOC100515497 __SEG__ Chr8 {Sus scrofa} MSRLLHAEEWAEVKELGDHHRHPQPHHLPQPPPPQPPATLQTREHHVYPAELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEADGRGELVRRSGG
VGGSSKSPGPVKVREQLCKLKGGVVVDELVCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGG
DQPPQQPASCKSDHHHLRASAPYEASAGTTTATGTPPASGGGQRPTPPGSCRTRFSVPTSAGGYSVQLEALHFSTFEDSALTAMMAQKNLSPSLPGGILQPVQEESSKTS
PRSHRSDGEFSPHSHYSDSDEAS*
57 >lcl|XP_003129436.1|Plus1624368..624910 NW_003535483 achaete-scute homolog 3-like LOC100518920 __SEG__ Chr9 {Sus scrofa} MMGHRNYSNLPDKPPVCADSAHLPLPRSFYLDPAVTVHLHPEGPVPAPYSQDLPLLPFSSDSLIVENRGEPRTFFSLPHPNYRRCDDAYGPAFIRRRNERERQRVKGVND
GYAQLRHHLPEQYLDKRLSKVETLRAAIKYINYLQALLDPEEAETKNHPRKRPSGTAATGRHPDPVFTII*
58 >lcl|XP_003129660.1|Plus1complement(41757..42344) NW_003300509 RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like LOC100524945 __SEG__ Chr9 {Sus scrofa} MPSSAPLRVAVVCMSNMNRSMEAHSILSKKGFRVRSFGAGSMVRLPGPAHHRPVLYSFRTPYRQMRRDLAWLDPDCYRRNGILHLLGRNERIKPCPERFQDCREAFDVIF
TCEESVYDRVVGHLCAREQETCQPVHVINVDMQDDLEDATLGSLVICELCQRLQQAEDMEDCLAELLLGVERKTGRSFLHTVCFY*
59 >lcl|XP_003129769.2|Plus1complement(1989288..1990352) NW_003535512 CREB/ATF bZIP transcription factor-like isoform 1 LOC100518742 __SEG__ Chr9 {Sus scrofa} MRHSLTKLLAASGSDSPTRSESPAPAATFSLPPDLSRAAAEDEGTAAAGSPGRKQPRGNEGESEAGRGGRGGVAVRAPSPEEMEEEAVASVPGDETEDMDFLSGLELADL
LDPRQPDWHLEPGLSSPGPLSSSGGGSESGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSGSDTGGGEKRRRKSPGGGGGSSGGNDNNQAATKSPRKAAAAAARL
NRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQQQDLLEEDDSAGGVCLH
VDKDKVSVEFCSACARKASSSLKM*
60 >lcl|XP_003130240.2|Plus1740369..740977 NW_003535585 twist-related protein 1-like LOC100516456 __SEG__ Chr9 {Sus scrofa} MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGSSGPGGAAGGGVGGGEEPGSPAQGKRGKKSAGCGGGGGGAGGGGSSSGGGSPQSYEELQTQR
VMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH*
61 >lcl|XP_003130241.1|Plus1709431..709925 NW_003535585 fer3-like protein-like LOC100516634 __SEG__ Chr9 {Sus scrofa} MAAYPQSCVDATVLDFVADLSLASPGHPLLCDFAPGVPYADHQDLVLQEGRARSLPRFEEEDPEEEGEVEEGEDEEVEEAGRGASLLGRPKRKRVITYAQRQAANIRERK
RMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLESFEKKETG*
62 >lcl|XP_003130649.1|Plus1complement(254202..256814) NW_003300710 zinc finger protein 281-like LOC100523859 __SEG__ Chr10 {Sus scrofa} MKVGSVFLSSGGGGAGSDGRAEMEPSFPPGMVMFNHRLPPVASFARPAGAAAPPPQCVLAAAPAAAPAAEPPPAPAPDVTFKKEPAAPGAAFPAQRTSWGFLQSLVSIKQ
EKPAEPEEPPGAPHPHYGGLFAGADERAPALGGGDGGGPGVIQDLSVLHPPPAPHPRDVLLGGGGRTDDPRGPEEPKQDAGVKKAKRPKPESQGIKAKRKPSASSKPSLV
GDGEGAVLSPSQKPHICDHCSAAFRSSYHLRRHVLIHTGERPFQCSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTHSGEKPYKCDTCQQYFSR
TDRLLKHRRTCGEAIAKGAPNSEPGSSNHSSLGSLAVLSQGNTSSSRRKAKSKSLAIENKEPKTGKANESPISNSISMQNYSVEMPTVSSSGGVIGSGIDELQKRVPKLI
FKKGSRKSTDKNYLNFVSPLPDLVGQKSLSGKPSGSLGIVSSSSVETIGLLQSTSGKQGQIGSNYDDAMQFSKKRRYLPTASSNSAFSVNVGHMVSQQSVIQSAGVGVLD
SEAPLSLIDSSALNAEIKACHDKSGIPDEVLQSILDQYSSKSESQKEDPFSITEPRVDLHTSGDHSELVQEDNLSPGTQTPSNDKASMLQEYSKYLQQAFEKSTNAGFTL
GHGFQFVSLSSPLHNHSLFPEKQIYTTSPLECGFGQSVTSVLPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLIDSQKNLETSSAFQASSQKLTSQKEQQK
NLESSAGFQIPSQELASQIDPQKDVEPRTTYQIENFAQAFGSQFKSGSRVPMTFITNSNGEVDHRARTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR*
63 >lcl|XP_003131095.1|Plus1complement(362732..363562) NW_003300849 transcription factor SOX-21-like LOC100517115 __SEG__ Chr11 {Sus scrofa} MSKPVDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPA
LKAGAGLHAGAGGGLVPESLLANPEKAAAAAAAAAARVFFPQSAAAAAAAAAAAAAGSPYSLLDLGSKMAEISSSSSGLPYASSLGYPTAGAGAFHGAAAAAAAAAAAAG
GHTHSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQLDPYPAAYAAAL*
64 >lcl|XP_003131582.1|Plus1complement(266990..268123) NW_003300915 transcription factor Sp6-like LOC100519513 __SEG__ Chr12 {Sus scrofa} MLTAVCGSLGSQHTDAPPASPPRLDLQPLQTYQGHTSPEAGDYPSPLQPGELQSLPLGPEVDFSQGYELPGASSRVTCEDLESDSPLAPGPFSKLLQPDMSHHYESWFRP
THSGTEDGSWWDLHPGTSWMDLPHTQGALTSPGHPGALQAGLGGYVGDHQLCAPPPHPHPHHLLPAAGGQHLLGPPDGAKALEAAAPESQGLDTSLDGAARPKGSRRSVP
RSSGQTVCRCPNCLEAERLGAPCGPDGGKKKHLHNCHIPGCGKAYAKTSHLKAHLRWHSGDRPFVCNWLFCGKRFTRSDELQRHLQTHTGTKKFPCAVCSRVFMRSDHLA
KHMKTHEGAKEEAAGAAAAAGEGKAGGAEPAGGKGKREAEGSSAPSN*
65 >lcl|XP_003131852.1|Plus1complement(580865..581539) NW_003535905 class A basic helix-loop-helix protein 9-like LOC100521580 __SEG__ Chr12 {Sus scrofa} MHRGAPGPGLGGLKGAEDSAEDLGNACLGARREFGVLRENGRPCGLGEAEETAGGRRRSRPVRSKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRR
AIHRITALSLVLRASPTPRWPCGHLECHGQAARAGDAGDPGCRPPQPASLPAGPFAPRCASCFPHAPLGRPTAVAEAQGAAQTSAGSWRRCPGAPSAWPRGHLRAGPGMG
YQHS*
66 >lcl|XP_003132925.1|Plus1complement(453807..453983) NW_003536211 DNA-directed RNA polymerases I, II, and III subunit RPABC4-like LOC100526078 __SEG__ Chr14 {Sus scrofa} MNTQKDIQPPKQQPMIYICGECHTENEIKSRDPIQCRECGYRIMYKKRTKRWVGFDAR*
67 >lcl|XP_003133166.1|Plus1complement(187257..188003) NW_003536267 zinc finger protein 32-like LOC100524111 __SEG__ Chr14 {Sus scrofa} MTEAHHKYDHSEATGSSSWDFQNSFRREKLEQKSPDSKTLQEDSPGVRQRVYECQECGKSFRQKGSLTLHERIHTGQKPFECTHCGKSFRAKGNLVTHQRIHTGEKPYQC
KECGKSFSQRGSLAVHERLHTGQKPYECAICQRSFRNQSNLAVHRRVHSGEKPYRCDQCGKAFSQKGSLIVHIRVHTGLKPYACTQCRKSFHTRGNCILHGKIHTGETPY
LCGQCGKSFTQRGSLAVHQRSCSQRLTL*
68 >lcl|XP_003133324.1|Plus1531794..532177 NW_003536351 activated RNA polymerase II transcriptional coactivator p15-like LOC100512195 __SEG__ Chr15 {Sus scrofa} MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQW
SQLKEQISDIDDAVRKL*
69 >lcl|XP_003133824.1|Plus191160..91642 NW_003301472 twist-related protein 2-like LOC100519927 __SEG__ Chr15 {Sus scrofa} MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLA
ARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH*
70 >lcl|XP_003134430.1|Plus1complement(322086..323078) NW_003536651 forkhead box protein S1-like LOC100524116 __SEG__ Chr17 {Sus scrofa} MQQQPPPGPPAPAAEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRR
RRRFTRRAGAEVAKGPAKARRGALRATGQDPGAPDAATGRQGPFLPELPEPKGLSFGGLVGALPASMCPATTDARPRPPSEPKEMPTSKLAGPGELPVATSSSPCPAFGF
PASFSEAEGFSKAPAPILAPEAAVGSSYQCRLQALNFCMGTDPGFEHLLASAAPSPAPPTPPASLRAPLPLPADPKEPWVAGSFPVQGGSGYPLGLTPCLYRTPGMFFFE
*
71 >lcl|XP_003134980.1|Plus12596683..2597741 NW_003536748 transcription elongation factor A N-terminal and central domain-containing protein LOC100156439 __SEG__ ChrX {Sus scrofa} MSDKNQVAAKAALIEQLMSKRNFEDLGNHLTELETLRVTKELLQETVVVRAVYRVLKHCPTAALKKKAKCLLSKWKALYKDAQVKAKGSPKLSPAGRQKEEHQRLSPNPS
QDAARGSSSSHSPQPSQDVAGAPEMNMPENSPGAGEPEAAHLRAGDPKSTDQSSGELRDPTRPVRAKCTELLYEALAAFSTEQPRADLWHRFAQEIEECIFTLHAKNLKK
YKTCIRSKIANLKNPRNSHLRENLLSGIMSPRAFAEMTVMDMASKELKQLRASYTESCIQEHSLPQGVEGTPTKKVRCRRCEKFNCQVTVIARGALFLPSWVRNAKPDEE
LMTYVICKECGEQWYHSKWVCL*
72 >lcl|XP_003135276.1|Plus11645460..1645798 NW_003536821 transcription elongation factor B polypeptide 1-like LOC100513836 __SEG__ ChrX {Sus scrofa} MDGEEKTYGGCEGPDAMYVKLISSDVHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVHMYFTYKVHYTKSSTEIPEFPIAPEIALELLMAANFL
DC*
73 >lcl|XP_003135483.1|Plus1complement(1541692..1542276) NW_003536860 RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like LOC100525973 __SEG__ ChrX {Sus scrofa} MQSLPLRVAVVCSSNQNRSMEAHSILSKRGFSVRSFGTGAHVKLPGPAPDKPNVYDFRTTYDQMYNDLLMKDKDLYTQNGILHMLDRNKRIKPRPERFQNCKDPFDLIIT
CEERVYDLVVEDLNSREQETCQPVHVINVDIQDNHEEATLGAFLICELCQCIQHTEDVDNEIEELLQEFEEKSGQTFLHTVCFY*
74 >lcl|XP_003353508.1|Plus11551871..1552740 NW_003534056 mothers against decapentaplegic homolog 6-like LOC100622927 __SEG__ Chr1 {Sus scrofa} MFRSKRSGLVRRLWRSRVVPDREEGGGSGGGGDEDGSKGSRSDPAPRPREGGGCSRPEVRPVALRRPRDAVGQRGPQGAGRRRRAGGPPRPMSEPGAGAGGSPLDVSEPG
GRGWLPESDCETVTCCLFTERDAAGAPRDAGDPLAGAALEAAGSGRSREARSRLLLLEQELKTVTYSLLKRLKERSLDTLLEAVESRGGVPGGCVLVPRADLRLGGQPAP
PQLLLGRLFRWPDLQHAVELKPLCGCHSFAAAADGPTVCCNPYHFSRLCGPGERAAPGRPSGFPSRPLP*
75 >lcl|XP_003353700.1|Plus1complement(111464..112786) NW_003534168 zinc finger and BTB domain-containing protein 26 ZBTB26 __SEG__ Chr1 {Sus scrofa} MSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDIEVQGHKIVFAAGSPFLRDQFLLNDSREVKISILQSSEVGRQLLLSCYSGVLEFPEMELVNYLTAASFL
QMSHIVERCTQALWKFIKPKQPMDSKEGCEPQSASPQSKEHQGDARGSPKQNSPCIHPSEDSMDMEDSDIQIVKVESIGDVSEVRSKKDQNQFISSEPTALHSSEPQHSL
INSTVENRVSEIEQNHLHNYALSYTGSDIIMASKDVFGPNIRGVDKGLQWHHQCPKCTRVFRHLENYANHLKMHKLFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKIC
GKTFSQKCSLQDHLNLHSGDKPHKCNYCDMVFAHKPVLRKHLKQLHGKNSFDNANERNVQDLTVDFDSFACTTVTDSKGCQPQPDATQVMDAGKLAQAVLNLRNDSTCVN
*
76 >lcl|XP_003354272.1|Plus1516515..516721 NW_003534321 RNA polymerase II elongation factor ELL2-like LOC100623205 __SEG__ Chr2 {Sus scrofa} MAAGGAAGLREEQRYGLSCGRLGQDNITVLHVKLTETAIRALETYQSHKVSWAVGRPAGLREEKGVPH*
77 >lcl|XP_003354344.1|Plus176495..77463 NW_003534373 transcriptional activator protein Pur-alpha isoform 1 PURA __SEG__ Chr2 {Sus scrofa} MADRDSGSEQGGAALGSGGSLGHPGSGSGSGGGGGGGGGGGGSGGGGGGAPGGLQHETQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEF
RDYLGDFIEHYAQLGPSQPPDLAQAQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPE
GTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEMKKIQEKQREKRAACEQLHQQQQQQQEETAAATLLLQGEEEGEED*
78 >lcl|XP_003354985.1|Plus1complement(343669..345012) NW_003534559 transcription factor SOX-11-like LOC100514639 __SEG__ Chr3 {Sus scrofa} MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHM
ADYPDYKYRPRKKPKMDPSAKPSASQSPEKNAAGGGSGGAGGGAGGAKTSKGSSKKCGKLKAPAAPAAGGAKAGAGKAAQPGDYGGAGDDYVLGSLRVSGAGGGGAGKTV
KCVFLDEDDEDDEDEDELQLRIKQEADEEDEEPPHPQLLQPPGQQPPQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAGATSGAGGGSRLYYSFKNITKQHPPPLA
QPALSPASSRSVSTSSSSSSSGSSSSSSSGGEDADDLMFDLSLNFSQSAHSASEQQLGGGAAAGNLSLSLVDKDLDSFSEGSLGSHFEFPDYCTPELSEMIAGDWLEANF
SDLVFTY*
79 >lcl|XP_003355012.1|Plus1368752..369756 NW_003299899 zinc finger protein 696-like LOC100627184 __SEG__ Chr4 {Sus scrofa} MPQQAALGEGGFHGEAVPGLFQGPPQAPGFLDPCAKEEAEERPGLAVDEETGGPSGREDSMSGSEVTLHTGHVTDGRGPWKGRPYQCSTCDRSFKCYSDAVKHQSIHSGE
KPYECSDCGKAFIHSSHVVRHQRTHNGERPYICKECGKAFSQSFNLVRHQRSHTGEKPYGCAECGKSFGQRSDAVKHRRIHTGERLYECSDCGKTFIHSSNVVRHQRIHH
GENPYECKECGKAFSQSSNLIQHQRVHTGEKPYACQECGRAFSRSSFLSEHRRIHTGEKPYECSECGRAFRALSGFFRHQRIHTGEKPFRCAECGRAFRLSFHLIQHRRV
HGTE*
80 >lcl|XP_003355031.1|Plus1complement(105468..107984) NW_003534589 zinc fingers and homeoboxes protein 2 ZHX2 __SEG__ Chr4 {Sus scrofa} MASKRKSTTPCMVRTSQVVEQDLPEEGDRAKEKGISTPQPETAKDTWAAEPENSSKENEVIEVKSMGETQSKKPQGGYECKYCPYSTQNLNEFTEHVDMQHPNVILNPLY
VCAECNFTTKKYDSLSDHNAKFHPGETNFKLKLIKRNNQTVLEQSIDATSHVVSITSSGPGSGDSDPGISVSKTPIMKPGKPKADAKKVPKKPEEAAPENHVEGTARLVT
DAAEILSRLGGVELLQDTLGHVMPSVQLPPNINLVPKVPVPLNTTKYNSALDTNATMINSFNKFPYPTQAELSWLTAASKHPEEHIRIWFATQRLKHGISWSPEEVEEAR
KKMFNGTIQSVPPTITVLPAQLAPTKVSQPILQTALPCQILGQTSLVLTQVTSGPATVSCAPITLAVAGVTNHGQKRPLVTPQAAPEPKRPHIAQVPEPPPKVANPPLTQ
TSERKKTKEQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDHRYRCQRGIVHITSESLAKDQLAIAASRHGRTYHAYPDFAPQKFKEKTQGQVKSLEDSFLK
SSFPTQAELDRLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKKGQDAAAPNGALSRLDQLSGAQLAGSLPSPSPAITKSQEQVHLLRSTFARTQWPTPQEYDQ
LAAKTGLVRTEIVRWFKENRCLLKTGSLKWMEQYQPQPVADDHGCDAPSRKGAKTILTESPKNGSEVAQPYYKDPKKLSEDDLEKLVPRAKAGSEQAKDGLPAKPSEATS
DRSEGSSRDGQGSDENEESGVVDWVEVTVGEEDAISDRSDSWSQTAAEGPAELADSDSDSVPAEAGQA*
81 >lcl|XP_003355105.1|Plus1complement(13337..14125) NW_003534647 XK-related protein 4-like LOC100627374 __SEG__ Chr4 {Sus scrofa} MAAKSDGRLKMKKSSDVAFTPLQNSDHSGSVQGLASGLPSGSGAEDEEAAGGGCCRDGGGCSRCCCCCCAGSGGSGGGSGGSGGPGGGGGGGGAGSAALCLRLGREQRRY
SLWDCLWILAAVAVYFADVGTDIWLAVDYYLRGQRWWFGLTLFFVVLGSLSVQVFSFRWFVHDFSTEDSATAAAASSYPQPGADCKTVVSSGSAAAEGEARPSTPQRQAS
NASKSNITAASSRAGGKHRSASCSFCIWLLQSLIHILQLGQIW
82 >lcl|XP_003355206.1|Plus1983808..984848 NW_003299870 hypothetical protein LOC100626698 LOC100626698 __SEG__ Chr4 {Sus scrofa} MSYQKKQPTPQPPVDCGKTSGGGGGGGGGGSGGGCVFYSGGGGGGGGYSGGGGSGGCSGGSSGGSIKYSGGGGGGGGGGSCYGGGGSSGCGGYSGGGGSAGCGGGGGGGS
GGSIKYSGGGGSSGCGGYSGGGGSGGCGGGGGGGSGGSGGSIKYSGGGGSSGCGGYSGGGGSSGGGCYPSGGGSSGGGCYPSGGGSSGGGSSGQQVQCQSYGGVSSGGSA
GGSSGCGGGSSGGGSGCGGGSSGGGSGYYSSSQQTSQTSCLPSQGYGGGSSGGSCGGSSGGGDCYFPSCGGGGGGGGSGCGGGSSGGGGGGSGCGGGSSGGGSGGGKGVP
VCHQTQQKQAPTWPCK*
83 >lcl|XP_003355417.1|Plus1229720..230877 NW_003534737 mTERF domain-containing protein 3, mitochondrial MTERFD3 __SEG__ Chr5 {Sus scrofa} MLWKLLMRSQPCRLCSFQKMLSAPKYRPFLASFTYTTDNQSNKENKMTVEKLYKLSVDIRKIRRLKGWVLLEDETYVEEIADILQQLGANQTAVASILERCPEAIICSPT
AINTQRELWQLVCKNKEELVKLIEQFPESFFTVKDQENQKLNVQFFQELGLKNVVISRFLTTASNIFHNPLEKNKQMIKILQESYLNLGGSEANMKVWLLKLLSQNPFIL
LKSSAAIKETLEFLQEQGFTNFEILQLLSKLKGFLFQLCPRSIQNSMSFTENAFKCTDHDLKQLVLKCPALLYYSVAVLEERIQGLLKEGISITQIRETPMVLELTPQIV
QYRIRKLNSLGYRVKDGHLAHLNGTKKEFEENFGKIQAKKGRPLFNPVAPLDVEE*
84 >lcl|XP_003355453.1|Plus1complement(312839..314083) NW_001886315 transcription factor Sp7 isoform 2 LOC404701 __SEG__ Chr5 {Sus scrofa} MLTAACSKFGGSSPLRDSTTLGKAGTKKPYSVGSDLSAPKTMGDAYPAPFSSTNGLLSPAGSPPAPTSGYANDYPPFSHSFPGPTGSQDPGLLVPKGHSSSDCLPSVYTS
LDMAHPYGSWYKAGIHAGISPGPGNAPTPWWDMHPGGNWLGGGQGQGDGLQGTLPTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSG
QLEGSGGAKPPRGAGTGGSAGYGGSGAGRSSCDCPNCQELERLGAAAAGLRKKPIHSCHIPGCGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTH
TREKKFTCLLCSKRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSAAGEEEASQTPRPAASPAPPEKAPEGSPDQSNLLEI*
85 >lcl|XP_003355917.1|Plus1complement(812548..813426) NW_003534949 zinc finger protein OZF-like LOC100620867 __SEG__ Chr6 {Sus scrofa} MSHLSQQRICSGENPFACKVCGKVFSHKSTLTEHEHFHNREKPFECNECGKAFSQKQYVIKHQNTHTGEKLFECNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKAFI
QKSNLIRHQRTHTGEKPFVCKECGKTFSGKSNLTEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTGEKPYECNECGKAFSQRTSLIVHVRIHSGDKPYECNVCGKA
FSQSSSLTVHVRSHTGEKPYGCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQKSHHIRHQKIHTH*
86 >lcl|XP_003355918.1|Plus1complement(939625..940503) NW_003534949 zinc finger protein OZF-like LOC100621065 __SEG__ Chr6 {Sus scrofa} MSHLSQQRICSGENPFACKVCGKVFSHKSTLTEHEHFHNREKPFECNECGKAFSQKQYVIKHQNTHTGEKLFECNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKAFI
QKSNLIRHQRTHTGEKPFVCKECGKTFSGKSNLTEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTGEKPYECNECGKAFSQRTSLIVHVRIHSGDKPYECNVCGKA
FSQSSSLTVHVRSHTGEKPYGCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQKSHHIRHQKIHTH*
87 >lcl|XP_003356121.1|Plus1108168..109136 NW_003534965 zinc finger protein 524-like LOC100620279 __SEG__ Chr6 {Sus scrofa} MDTSSPDAWPSPFPREEEKPLALPPPVPQGRRGQRPAGATSSNQTLKTTLPRKRGRPPKSGQEPPVAQGVTAPVVSDGGSDLLLIDDQGVPYTVSEGSVASGPESSSPKK
APHFCLVCLRAFPYLSDLERHSISHSELKPHECKDCGKTFKRSSHLRRHCNIHAGLRPFRCPLCPRRFREAGELAHHHRVHSGERPYQCPICRLRFMEVNTLRRHIKRKH
PEAMEVPLCLPDPEPEPLWDDDGIPATAEAEEGGLEGKELACPRPPATAPQAEIRAGSRAGAGPEQGGPDTLTSGGLPVVGGGWGCGPQLLDPAAFCHPPPD*
88 >lcl|XP_003356122.1|Plus1153245..153841 NW_003534965 zinc finger protein 581-like LOC100620373 __SEG__ Chr6 {Sus scrofa} MLVLPTPCPQPLALPSAEAMEAPPPRTDGSPEPGPSSSSTGCAQTSSTSRPNHYLLIDTQGVPYTVLVDEESQRESGPDGGSTQKKCYSCPVCSRVFEYMSYLQRHSITH
SEVKPFECDTCGKAFKRASHLARHHSIHRAGGGRPHGCPLCPRRFREAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP*
89 >lcl|XP_003356123.1|Plus1266902..267498 NW_003534965 zinc finger protein 581-like LOC100620473 __SEG__ Chr6 {Sus scrofa} MLVLPTPCPQPLALPSAEAMEAPPPRTDGSPEPGPSSSSTGCAQTSSTSRPNHYLLIDTQGVPYTVLVDEESQRESGPDGGSTQKKCYSCPVCSRVFEYMSYLQRHSITH
SEVKPFECDTCGKAFKRASHLARHHSIHRAGGGRPHGCPLCPRRFREAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP*
90 >lcl|XP_003356126.1|Plus1complement(1120085..1121194) NW_003534965 zinc finger protein 135-like LOC100620869 __SEG__ Chr6 {Sus scrofa} MRGTQCAELQEAWRQDPPDDPEPLLGELTSVQDRGHRSYGGGRNALPTAHTPRNAAAEGPRHRCPIRGKSFEQQADLLDHQKISTGRKPFQCGECGKAFSYPSALKVHQR
THTGERPFPCAQCGKAFSHSSALLLHRRVHTGERPYACGDCGRAFSQSSSLVLHRRTHTGERPYDCPACGKAFSRHSALVEHRRVHTGERPYACSLCGRAFSQSAHLARH
RKVHVQPKAHGCGHCGRAFRSPAALLQHRRIHTGERPFGCPECGKAFTQRPYLAQHLRVHAGERPFECERCGKAFGKCAHLARHRETHACVRAPAGRARGGDAPQGRADA
GTSVAGRRRQRRPPNLCGDCGRVFRCSAALAQHRRLQAC*
91 >lcl|XP_003356797.1|Plus11090711..1092681 NW_003535270 YLP motif-containing protein 1-like LOC100623185 __SEG__ Chr7 {Sus scrofa} MIPRGPASQFYITPNTSLSPRQSGPQWKGPKPAFGQQHQQQPKSQAEPGNKEPLADTSSNQQKNFKMQSAAFSIAADVKDAKAAQSNENLSDSQQEPPKSEVSEGPIEPS
DWDQNSQSMETQMDKAQGVTQPVPLANKPVPSQSAFPSKTGGMEGGAAVATSSSLNADNDFKPLGIGLSHLENNQDKGLPRPDNRDNRLEGSRGSSSSYRGPGQSRMEDT
RDKGLVNRGRGQAISRGPGLVKQEDFRDKMMGRREDSREKMSRGEGSRERGLVRPGSSREKVPGGLQSNQDRGRAGSRERGPPRRAGSQERGPPRRPGSRERVPPRRAGS
RERGSPRGPGSRERGMGRPDFGRDRGPFRPEPGDGGEKIYPYHRDEPPRAPWNHGEERGHEEFPLDGRNAPMERERLDDWDRERYWRECERDYQDDTLDPYNREDRFSAP
PSRSHDEDRRGPWWDDWERDQDMDEDYNREMDRDLDRDVDRIGRPMDMYDRNLDNEWDRDYGRPLDEQESQFRERDIPSLPPLPPLPPLPPLDRYRDDRWREERNRDHGY
DRDFRDRGELRIREYPERGDTWREKRDYIPDRMDWERERLSDRWYPSDVDRHSPMAEHVPSSHHSSEMMGSDANLDSDQGLGGVMVLSQRQHEIILKAAQELKMLR*
92 >lcl|XP_003357516.1|Plus1complement(488424..489887) NW_003535586 transcription factor Sp8 isoform 1 SP8 __SEG__ Chr9 {Sus scrofa} MLAATCNKIGSPSPSPSSLSDSSSSFGKGFHPWKRSSSSSSGSCNVVGSSLSSFGVSGASRNGGSSSAAAAAAAAAAAAAALVSDSFSCGGSPGSSAFSLTSSSAAAAAA
AAAAAASSSPFANDYSVFQAPGVSGGSGGGGGGGGGSSAHSQDGSHQPVFISKVHTSVDGLQGIYPRVGMAHPYESWFKPSHPGLGAAGDVGSAGASSWWDVGAGWIDVQ
NPNGAAALPGSLHPAAGGLQTSLHSPLGGYNSDYSGLSHSAFSSGASSHLLSPAGQHLMDGFKPVLPGSYPDSAPSPLAGAGGSMLSAGPSAPLGGSPRSSARRYSGRAT
CDCPNCQEAERLGPAGASLRRKGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLSKHVKTHSGG
GGGSAGSGSGGKKGSDTDSEHSTAGSPPCHSPELLQPPEPGHRNGLE*
93 >lcl|XP_003358280.1|Plus1complement(23313..24824) NW_003535912 zinc finger protein 3 homolog ZFP3 __SEG__ Chr12 {Sus scrofa} MGTETKEVIPKEEISEESEPRGAILDTFPKVVFQGHKFGAACEEATLEGPSRAPAEEAMEQVAPEERHLASGLIIFKKSPSSEEDQEDDEGEQACSLSPSPALPQGDAAA
EAAGTLAASGQNFMQHLGPNKTHRSSGGEKPHSCKECGKAFNQNSHLIQHMRVHSGEKPFECKECGKTFGTNSSLRRHLRIHAGEKPFACNECGKAFIQSSHLIHHHRIH
TGERPYKCEECGKAFSQNSALILHQRIHTGEKPYECNECGKTFRVSSQLIQHQRIHTEERYHECNECGKAFKHSSGLIRHQKIHTGEKPYLCNECGKGFGQSSELIRHQR
THTGDKPYECNECGKTFGQNSEIIRHIRIHTGEKPYVCKECGKAFRGNSELLRHERIHTGEKPYECFECGKAFRRTSHLIVHQRIHTGEKPHQCNECARTFWDNSELLLH
QKIHIGEKPYECKACEKTFSQHSQLIIHQRIHTGEKPYECQECQKTFSRSSHLLRHQSVHCVE*
94 >lcl|XP_003358436.1|Plus1complement(116010..117449) NW_003535957 zinc finger protein 167 ZNF167 __SEG__ Chr13 {Sus scrofa} MECSDLPPKQESSKESEASDRTSGVLYEVIPGGPVAGDAYEEALEKLGAQPSDEEGSRLESDLLEITQEDKNKCTEDGCAEYKDLGEHPDLSPSPVGHQGVLKGQKFYQC
DECGKAFNWSSHLIGHQRIHTGEKPYECTECGKTFRQTSQLIVHLRIHTGEKPYECSDCGKTYRHSSHLIQHQRLHSGEKPYKCSECGKAFNESSKLFDHQRIHTGEKPY
GCSECGAVFSRSKSLVRHQVLHTGEKPYKCNECGKAFCSNRNLIDHQRIHTGEKPYECNECGKAFSRSKCLNRHQSLHTGEKPYKCSECGKAFNQISQLAEHERIHTGEK
PFECNECGKAFSLSKCLIRHQRLHTGEKPYKCKECGKSFNQNSYLIIHQRIHTGEKPYGCIECGKVFSHNSSLMVHQRTHTGEKPYKCKDCGKAFRDSSQLTVHQRVHTG
EKPYECIECGKAFSQRSTFNHHQRTHTGEKHSGLARSIS*
95 >lcl|XP_003358439.1|Plus1270743..271558 NW_003535957 zinc finger protein 501-like LOC100627100 __SEG__ Chr13 {Sus scrofa} MSSSQILLQLKHQRLNRHKKPLKCSECGKFFTQRSSLTQHERIHTGEKPYICTKCGTCFRKQSNLTQHLRIHTGEKPYKCNECEKAFQTKAVLVQHLRIHTGEKPYKCNE
CGKAFCQSPSLIKHLRIHTGEKPYKCSECGKAFSQSICLTRHQRSHSGARPYKCNDCGKAFNQSACLMQHQRIHSGEKPYTCTKCGKAFTQNSSLVEHDRTHTGEKLYKC
SECEKTFRKQAHLSEHYRIHTGEKPYECAVCGKAFRHSSALARHQRLHAGE*
96 >lcl|XP_003358540.1|Plus11452027..1452401 NW_003535976 transcription initiation factor TFIID subunit 13-like LOC100624071 __SEG__ Chr13 {Sus scrofa} MADEEEDPTFEEESEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEEL
KRARKAFDEANYGS*
97 >lcl|XP_003358632.1|Plus1complement(65837..66970) NW_001885344 forkhead box protein L2-like LOC100622956 __SEG__ Chr13 {Sus scrofa} MMASYPEPEDAAGALLAPETGRTAKEPEAPPPLSPGKGGGGGASTAPEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLN
ECFIKVPREGGGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAHFQPGKGLFGAGGAAGGCGVAGAGADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMPYASCQ
MAAAAAAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGPYSRVQSMALPPGVVNSYNGLGGPPAAPPPPPHPHSHPHAHHLHAAAAPPPAPPHHGAAAPPPGQLSPASPAT
AAPPAPAPTNAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLDL*
98 >lcl|XP_003358664.1|Plus1complement(355111..355389) NW_003536021 mediator of RNA polymerase II transcription subunit 12-like protein-like LOC100623487 __SEG__ Chr13 {Sus scrofa} MDMRRKPTLLTAFVGGSRLDPTGSFVPTNTKQALSNMLQRRSGAMMQPPSLHAITSQQQLIQMKLLQQQQQQRLLRQAQTRPFQQVCPDPAV*
99 >lcl|XP_003358962.1|Plus1complement(21850..22086) NW_001885273 hypothetical protein LOC100626031 LOC100626031 __SEG__ Chr13 {Sus scrofa} MYCSYYSNPWGYGCGKGYGYGCSPYYGYGWGPFYGYGCGYGSRYGCGYGSCYGGGYGSGSSYCSYRPVCYRRHYSSCC*
100 >lcl|XP_003358963.1|Plus1complement(25128..25364) NW_001885273 hypothetical protein LOC100626113 LOC100626113 __SEG__ Chr13 {Sus scrofa} MYCSYYSNPWGYGCGKGYGYGCSPYYGYGWGPFYGYGCGYGSRYGCGYGSCYGGGYGSGSSYCSYRPVCYRRHYSSCC*
101 >lcl|XP_003358964.1|Plus1complement(15709..15945) NW_001885273 hypothetical protein LOC100626212 LOC100626212 __SEG__ Chr13 {Sus scrofa} MYCSYYSNPWGYGCGKGYGYGCSPYYGYGWGPFYGYGCGYGSRYGCGYGSCYGGGYGSGSSYCSYRPVCYRRLYSSCC*
102 >lcl|XP_003358969.1|Plus113284..13520 NW_001885273 hypothetical protein LOC100626675 LOC100626675 __SEG__ Chr13 {Sus scrofa} MYCSYYSNPWGYGCGKGYGYGCSPYYGYGWGPFYGYGCGYGFRYGCGYGSCYGGGYGSGSSYCSYRPVCYRRRYSFCC*
103 >lcl|XP_003358972.1|Plus1complement(40075..40311) NW_001885273 hypothetical protein LOC100626960 LOC100626960 __SEG__ Chr13 {Sus scrofa} MYCSYYSNPWGYGCGKGYGYGCSPYYGYGWGPFYGYGCGYGSRYGCGYGSCYGGGYGSGSSYCSYRPVCYRRHYSSCC*
104 >lcl|XP_003358977.1|Plus1478923..479894 NW_003301213 LOW QUALITY PROTEIN: oligodendrocyte transcription factor 2-like LOC100152482 __SEG__ Chr13 {Sus scrofa} MDSDASLVSSRPSSPDPDDLFLPARSKGSGGSGFTGGTVSSSTPSDCPPELSTELRGAMGAAGGHPGDKLGGGGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLR
LKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAGRRARSAPPGRAPP
HLASGRGRRRCSCGRRRGVQRLPARLRVVIGRLDSAPSRPAQVSIGGISSPAGGRGRQQRGQWRLPALGRHALPLQHVPGATAAPPRVGHGRRQPAAPHLRRQV
105 >lcl|XP_003358979.1|Plus141176..41985 NW_003536137 oligodendrocyte transcription factor 1-like LOC100620095 __SEG__ Chr13 {Sus scrofa} MYYAVSQARVNAAPATMLRPQRPGDVQLGTSLYELVGYRQPPSSSSSSSTSSSTTGPLLPKAAREKLEAPAEPPGTGSGPGAHTGGSSRADAKEEQQQQLRRKINSRERK
RMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDE
PPCGQFALPGGGPGGGAGSPGLCTCAVCKFPHLVPAGLGLAAVQAQFSK*
106 >lcl|XP_003359079.1|Plus1complement(26839..27840) NW_003301229 early growth response protein 3 isoform 3 EGR3 __SEG__ Chr14 {Sus scrofa} MDIGLTNEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGEVEAMYPALPPYSNCSDLYSEPVSFHDPQ
GNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERP
HACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEKKAEKGGAPSASSAAPVSLAPVVT
TCA*
107 >lcl|XP_003359148.1|Plus1668510..668686 NW_003536211 DNA-directed RNA polymerases I, II, and III subunit RPABC4-like LOC100622197 __SEG__ Chr14 {Sus scrofa} MNTQKDIQPPKQQPMIYICGECHTENEIKSRDPIQCRECGYRIMYKKRTKRWVGFDAR*
108 >lcl|XP_003359263.1|Plus1complement(11363..11830) NW_003536246 protein atonal homolog 7-like LOC100624800 __SEG__ Chr14 {Sus scrofa} MKSCKPCNPPAAAGARAAPPCTGGAAECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERD
WVNLHCEHFGRDHYLPFAGAKLPGESEPYGQRLFGFQPESFQMAS*
109 >lcl|XP_003359265.1|Plus1complement(238588..239055) NW_003536246 protein atonal homolog 7-like LOC100624999 __SEG__ Chr14 {Sus scrofa} MKSCKPCNPPAAAGARAAPPCTGGAAECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERD
WVNLHCEHFGRDHYLPFAGAKLPGESEPYGQRLFGFQPESFQMAS*
110 >lcl|XP_003359541.1|Plus1complement(186243..187292) NW_003536410 purine-rich element-binding protein gamma isoform 1 PURG __SEG__ Chr15 {Sus scrofa} MERARRRGGGGGGGRGRGGKNVGGSGLSKSRLYPQAQHPHYPHYAASATPSQAGGAAEIQELASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLS
LSVAAELKDCLGDFIEHYAHLGLKGHRQEHGHGKEQSSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHTLGQ
EQTIVLPAQGMIEFRDALVQLIEDYGEGDIEDRRGGDDDPVELPEGTSFRVDNKRFYFDVGSNKYGIFLKVSEVRPPYRNTITVPFKAWTRFGENFIKYEEEMRKICNSH
KEKRMDGRRASGEEQECLD*
111 >lcl|XP_003359615.1|Plus1complement(29878..31173) NW_003536447 nuclear factor erythroid 2-related factor 2-like LOC100626963 __SEG__ Chr15 {Sus scrofa} MDYQLLKIFNLDLRSVNFFSTQCLNIQNDNLAETSTVPSPETKPTEIDNYHFYSPNPSLEKEVGNCSPHFLSAFEDSFSSILSTEDSSQMTVNSLNSYATGNTDFGDEFY
SAFIAEPSTSNSMPSSATLSQSLSELLYGPIDLSDLSLCKAFNQDHRESTTAEFNDSDSGISLTPSPSMASPEHSVESSIYGDTLLGFSDSEMEELDSAPGSVKQNSPKT
QPVQPSGDTVQPLSPPQGNSAPVCDAQSENTPKKEVPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVDDFNEMMSKEQFNEAQLALIRDIRRR
GKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKN*
112 >lcl|XP_003359626.1|Plus1467083..468153 NW_003301401 neurogenic differentiation factor 1 NEUROD1 __SEG__ Chr15 {Sus scrofa} MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHETDKKEDDLEAMNAEEDSLRNGGEEEEEDEDLEEEEEEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARE
RNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNQDMPPHLPTASASFPVHPYS
YQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSGAAAPRCEIPI
DNIMSFDSHSHHERVMSAQLNAIFHD*
113 >lcl|XP_003359847.1|Plus1522746..523543 NW_003536564 transcription initiation factor TFIID subunit 9-like isoform 2 LOC100515933 __SEG__ Chr16 {Sus scrofa} MESGKMASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPY
SGPRLPPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTQQTMSVPAKVGTPVSLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIG
SKNILITTNMVSSQNTASESSNALKRKREDDDDDEDDDDDDYDNL*
114 >lcl|XP_003359913.1|Plus1complement(181042..181926) NW_003536609 zinc finger protein 42 homolog LOC100627512 __SEG__ Chr17 {Sus scrofa} MDQQLKKREKKGLGGRAVSRDQSQAAQQEPPDEAWTLSDEDVCYETSFRVVEEDSFSDCYIECIIRGEFSEPLVEEDSLLKSLDCLKEGSEQELSQQVLTASSLLDCSLE
YMKKGAKQELPQPSVGENSLLEFSEYVPGKKLPPGKIPSTDFSDPEALTECARTKPSKNKSAPEKIVCPESGCTREFISRASLRKHLSVHSPRDHVCAECGKAFKESAKL
KRHFLVHTGEKPFPCTFEGCGKRFSLSFNLRTHVRIHTGEKPFVCPFEGCRRKFIQSNNMKSHLLTHTKANTNQ*
115 >lcl|XP_003360043.1|Plus1complement(466464..467435) NW_003536659 transcription factor MafB-like LOC100622632 __SEG__ Chr17 {Sus scrofa} MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEA
LIGSHPVPQPLQSFDGFRGAHHHHHHHHPHPHHAYPGAGVAHDELGPHAHPHHHHHHQASPPPSSAASPAQQLPTSHPGPGPHAAATATAAGGSGSVEDRFSDDQLVSMS
VRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL*
116 >lcl|XP_003360383.1|Plus1478633..479580 NW_003536786 forkhead box protein R2-like LOC100620660 __SEG__ ChrX {Sus scrofa} MDLKLKNPDFWYSLHGQVPGLLDWDMGNEFFLPCTTDQCPLAEQNLAKYRLRVMESPKVPQEKRPSPGKDGPNSEPNLWMWVNPNIVCPFGSQEASKPSKRKNVASIFPS
PQLLPKDEESNCSEAIVMESLPSSSGKQSPPQKRLTSSPSDWELTEEETGEQDNNSSVALKSPNKECFHSQKLWQGDSQERKSWPRPPLNYSHLIALALRNSPPCGLNVQ
EIYSFTQQHFPFFWTAPDGWKNTIRHNLCFLGSFEKVPVSLPDGANAKPRSGLWRLTEEGHRRFQEETRALASARRESIQQCMSQPDVMTSLFGL*
117 >lcl|XP_003360450.1|Plus1complement(391826..392692) NW_003536831 mortality factor 4-like protein 2-like LOC100524842 __SEG__ ChrX {Sus scrofa} MSSRKQGSQTRGQQSAEEDNFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEAALPGRWGGRSAETPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVE
SEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMS
QVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNAASLFTASDYKVASAEYHRKAL*
118 >lcl|XP_003360468.1|Plus1complement(<5..2119) NW_001886669 insulin receptor substrate 4-like LOC100622674 __SEG__ ChrX {Sus scrofa} MASCSFARDQATRRLRAAAAATAAALAAVATTPLLSSGTPTALIGTGSSCPGAMWLSTATGSRSDSESDEEDLPVGDEVCKRGYLRKQKHGHRRYFVLKLETADAPARLE
YYENARKFRHSVRAAAAAAAAAASGAAVPALIPPRRVITLYQCFSVSQRADAKYRHLIALFTQDEYFAMVAENESEQESWYLLLSRLILESKRRRCGTPGAQPDGEPAAL
AAAAAAEPPFYKDVWQVIVKPRGLGHRKELSGVFRLCLTDEEVVFVRLNTEVASVVVQLLSIRRCGHSEQYFFLEVGRSTVIGPGELWMQVDDCVVAQNMHELFLEKMRA
LCADEYRARCRSYSISIGAHLLTLLSARRHLDMLPLEPGGWLRRSRFEQFCHLRAIGDGEDEMLLARRYITPSEPLPPSRRGRLHLPRGRRSRRAVSVPASFFRRLAPSP
VRVPQPAEAPSEGACLPSKASGSGSGNSGEEENPQGKEGQEENGGDYMPMNKWGSGNGRGSGGGQGSSGQGPSSQSSGGNQCSGRGHGSGGGRGSSGGQGSSGQGSGGQG
AGGNQCSGDGQGTTGGHGSGSGQGAGGGHGSGRGQGPGDGHGSGGGKNSGGGRGSGSGKGSDGTGERGKSLKKKSYFGKLTQSKQQQMPPPPPPPPPAAATGGKGKSGGR
FRLYFCADRGAPKERKETKEVKVTENPEGAARGPHRARAFDEDED
119 >lcl|XP_003360512.1|Plus1complement(1089242..1090588) NW_003536858 transcription factor SOX-3-like LOC100623770 __SEG__ ChrX {Sus scrofa} MRPARDNASGASSLQVPADLARSASSRLPFPPDPPAHRPPSAPPTESSGLFTVAAPAPGAPSPPATLAHLLPAPAMYSLLETELKNPVGPPTPAAGAGGPAAPGGAGKSG
ANAAGGANAGGGSGGGASGGGGGGGGSDQDRVKRPMNAFMVWSRGQRRKMALENPKMHNSEISKRLGADWKLLTDAEKRPFIDEAKRLRAVHMKEYPDYKYRPRRKTKTL
LKKDKYSLPGGLLPPGAAAAAAAAAAAAAASSPVGVGQRLDTYTHVNGWANGAYSLVQEQLGYAQPATMSSPPPPPALPQMHRYDMAGLQYSPMMPPGAQSYMNAAAAAA
AASGYGGMAPSAAAAAAAAYGQQPATAAAAAAAAAAMSLGPMGTVVKTEPSSPPPAIASHSQRACLGDLRDMISMYLPPGGDAADAASPLPGGRLHSVHQHYQGAGTAVN
GTVPLTHI*
120 >lcl|XP_003360538.1|Plus1complement(617299..618426) NW_001886700 zinc finger protein 275-like LOC100623368 __SEG__ ChrX {Sus scrofa} MGEDAQSQDTASTSSPRAGEPSAEVKQSGDSEGRGGSPQNPPVEHHFACKECGDAFRLKVLLVQHQRIHSEEKGWECGDCGEVFRGASEFNEHRKSHAAPEPRPGPSRAL
DEAAAKGEQMEREAKPFECDECGKRFKKNAGLSQHLRVHSREKPFGCEECGRAFKVNTHLFRHQKLHTSEKPFACKTCSRDFLDRQELLKHQRMHTGHLPFDCDDCGKSF
RGVNGLAEHQRIHSGAKPYGCPHCGKLFRRSSELTKHRRIHTGEKPYACGQCGKAFRQSSSLLEHQRIHTGERPYACGDCGKAFRGPSDLIKHRRIHSGLKPYECDTCGK
AFRRSSGLSRHRRTHSGARRCECSECGRVFKRRSALQKHQPSHHE*
121 >lcl|XP_003360585.1|Plus1complement(122106..122816) NW_003536874 sex-determining region Y protein-like LOC100625818 __SEG__ ChrY {Sus scrofa} MVQSYASAMFRVLKADDYSPAAQQQNILALGKGSSLFPTDNHSSKDGRETRGSGRESGQDRVKRPMNAFIVWSRDQRRKVALENPQMQNSEISKWLGCKWKMLTEAEKRP
FFEEAQRLQAVHRDKYPGYKYRPRRKGERAQNLLPAEAAVLCSQVRVEERMYPFTYTVAKAKCSGTESQLSHSQPMNITSSLLQQEDRCNWTGLCHSRVTSTRQIRADLP
FHRGLQPGLSHIYFPY*