SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor K    

ID / Description / Sequence
1 >lcl|NP_001005893.1|Plus1796220..797866 NW_047691 replication initiator 1 Repin1 __SEG__ Chr4 {Rattus norvegicus} MLERRCRGPTAMGPAHPWLFSGPSQESSQPNRGLRYQGKSVAQPGGPAPVKVHRCAHCRKRFPGWVALWLHTRRCQARLPLPCHECNQRFRHAPFLALHLQVHASAVPDL
GFICHLCGHSFRGWVALVLHLRAHSASKRPITCPECNKRFWRQKQLRAHLRRCQPPAPEARPFICGNCGRSFAQWDQLVVHKRVHVAEALEEAAAKALGPRPRGRPSVTA
PRPGGDAVDRPFQCACCGKRFRHKPNLIAHRRVHTGERPHQCPECGKRFTNKPYLTSHRRIHTGEKPYPCTECGRRFRHKPNLLSHSKIHKRSEVSAQAASHTGSHLIAA
EPMAQPALGVPLGSLRTPAEAPASLHSCTDCGRSFRLERFLRLHQRQHTGERPFTCTECGKNFGKKTHLVAHSRVHSGERPFACEECGRRFSQGSHLAAHRRDHAPERPF
VCPDCGKAFRHKPYLAAHRRIHTGEKPYVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTFDDEDRLLMHQKKHDA*
2 >lcl|NP_001007670.1|Plus1complement(30777980..30779386) NW_047334 zinc finger protein 672 Znf672 __SEG__ Chr10 {Rattus norvegicus} MFTAPGVAATRERPYSCSVCGKSFQYSAVLLRHERAHGGDKRFRCLECGERCARASDLRVHRWTHAGQTLYICSECGQSFSHSSLLDLHLGTHRRRSSTCPCRLCGRRFP
HVSALLLHRVRQHPPEKPHRCPLCARSFRQSALPFHLARAHPPETTIATAPAPSTLYHCTQCPRAFHSSAGLRNHSRIHVVPSLSDPGAEAHRCGVCGKSFSKSSTLTRH
LQRHSGEKPFKCPECGKGFLESATLVRHQRTHTGEKPYACNDCGRCFSESSTLLRHQRSHQGERPHICATCGKGFGQRYDLVVHQRSHTGERPFPCPECGRGFTDRSDLT
KHLRTHTGEKPYHCELCGKRFTCISNLNVHLRNHAGHKPHKCPECGKSFSVASKLALHRKTHLGERTAECTECGKFFSHGRSLSQHQRSHRRARAAAMAATTTTTVVTEM
TIGPSLTLTGPTEQEKSGLLVSTFQETC*
3 >lcl|NP_001007715.1|Plus1complement(588381..589247) NW_048046 mortality factor 4 like 2 Morf4l2 __SEG__ ChrX {Rattus norvegicus} MSSRKQASQTRGQQSAEEDNFKKPTRSNMQRSKMRGAASGKKSAGSQPKNLDPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEVPQPPRKKRARADPTVE
SEEAFKSRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVGGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMS
QIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASADYHRKAL*
4 >lcl|NP_001011999.1|Plus1complement(8525966..8526904) NW_047399 mortality factor 4 like 1 Morf4l1 __SEG__ Chr13 {Rattus norvegicus} MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDANLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKT
KTNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFLSSCQEECGFHFGGLCKL*EVSRKYR**GVCC**GCGG
DKGVLQCNVGHSATLQI*ETTVC*NSGRSPGCTHVPGCELERCWPIHL*MRKALLYY*TIYMISSSTWQRILQLCSVPVIMKWLLLSTIGKPC
5 >lcl|NP_001012030.1|Plus1<544879..547497 NW_047396 zinc finger protein 281 Zfp281 __SEG__ Chr13 {Rattus norvegicus} GGSGSSGSSGSGGSRRAEMEPTFPQSMVMFNHRLPPVTSFTRPAGTAAPPPQCVLSSSTSAAPAAEPPPPPAPDMTFKKEPAASAAAFPSQRTSWGFLQSLVSIKQEKPA
DPEEQQSHHHHHHHHYGGLFAGAEERSPGLGGGEGGSHGVIQDLSILHQHVQQQPAQHHRDVLLSSSGSRTDDHGNEEPKQDTNVKKAKRPKPESQGIKAKRKPSASSKP
LVGEGEGAVLSPSQKPHICDHCSAAFRSSYHLRRHVLIHTGERPFQCSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTHSGEKPYKCDTCQQYF
SRTDRLLKHRRTCGEAIAKGAASAEPGSSNHNNMGNLAVLSQGNTSSSRRKSKSKSIAVENKEHKTGKTNESQMSNNINMQSYSVEMPTVSTSGGIIGTGLDELQKRVPK
LIFKKGSRKNTDKSYLNFVSPLPDVAGQKSLSGKPSGSLGIVSNNSVETISLLQSASGKPGPISSNYDDAMQFSKKRRYLPTASSNSAFSINVGHMVSQQSVIQSAGVSV
LDNEAPLSLIDSSALNAEIKSCHDKSGIPDEVLQSILDQYSSKSEPQKEDPFNLTEPRVDLHTSGEHSELVQEEHLSPGTQTPSNDKASVLQEYSKYLQQAFEKSTNAGF
TLGHGFQFVSLSSPLHNHTLFPEKQIYTTSPLECGFGQSVTSVLPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLIDSQKNLETSSAFQSSSQKLTSQKEQ
QKNLESSTSFQIPSQELASQIDPQKDIEPRTTYQIENFAQAFGSQFKSGSRVPMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR*
6 >lcl|NP_001012091.1|Plus1complement(33450108..33451091) NW_047658 forkhead box S1 Foxs1 __SEG__ Chr3 {Rattus norvegicus} MQQPPTAESLAPSTEPSKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFQHGSFLRR
RRRFTKRTGAQGTKGPVKADHRPLRATSPDQGAPNTTTGRLCPFPPEVPNPKGFGGLMGSLPANMCPTTSDTRPQLPTGPKDMCSAKSGGPRELSEATSPSPCPAFGFSS
AFSEAESLGKAPTPSVAPESIGSSYQCRMQTLNFCMGADPGLEHLLTSAVATPGSSTPSASHRAPLPLPADSKEPWVPGGFPVQGGSGYPLGLPPCLYRTPGMFFFE*
7 >lcl|NP_001012132.1|Plus1complement(11954151..11955332) NW_047815 heat shock transcription factor, Y linked 2 Hsfy2 __SEG__ Chr9 {Rattus norvegicus} MAEAPSDMLDVSPNSLSTDSETSSGDPWCDNNTGQKDSELWAIIEESAFQVLAQRFLIKRPPHTLCASEPDEDSNLFSMTFPRKLWKIVGSDKFKSIWWDEDGTYIVINE
ELFKKEVLERKAPFRIFETDSMKSLVRQLNLYGFRKMRQNFQRSASLPDFLAEEKGISASCKLQFYQNPNFLRDCPHLIERMKRRIGIKTVSRGAAPSLPDFKNKHFRPD
LGKMDDHSLGVAVQTSERNLLSGSSISNVYLRQKPSLTQGSSDSMDVIRSDFSLATSSSFRPPEEVLTHRPAPLNDVSSLHMDSQRIYTQANDSTVNFIITSITQNRRDM
SHLWNSCIEMQGEPSFQPGFPHFSSSSSTYSDSKAKGEPELPIHKERVASTTLASTSNHHPSS*
8 >lcl|NP_001012489.1|Plus1complement(1019861..1023472) NW_047801 zinc finger and BTB domain containing 38 Zbtb38 __SEG__ Chr8 {Rattus norvegicus} MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNVLAASSLYFKNIFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVRRQETVTDLAAA
GKRLGISFLEDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPRITNAFSIIETENSNSMFSPLDLRASFKKVSDAMRTTSLCQERASVCPEAEPVRTLAE
HSYAVSSITEAYRSQPLREHDSSSSSGKTGKENGEALTTKAKPCRKPKTQTQDSDSTTENMPLPLVTCPEVNQERSPQPAPILSHSEPPSSEGDVHFPREDENQPSETPG
PPAAEVPPLVYNCSCCSKSFDSSTLLGAHMQLHKPTQDPFVCKYCNKQFTTLNRLDRHEQICMRSSHMPMPGGNQPFLENYPTIGQDGGSFTSPDSLVPESRIGELSSAG
SALSDADHMVKFVNGQMLYSCVVCKRSYVTLSSLRRHANVHSWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCIFCLETFMTYYILKNHQKSFHAIDHRLSISKKT
ANGGLKPTVYPYKLYRLLPMRCKRAPYKSYRNSSYESAQGNRQRNESPPDTFVIPNLPSSEMPTLNFQDGRNSLTSSPAIPVETPSWQGTPTSAKVKNAEGLKWRKQALK
TDLVDSAEVSISSIGNSVSTTLQAEPVCVSSGEHSASVISYSGSVPSVIVHSSQFSSVIKHSNAIACLANSNHQSPSQPVASPSLIKDSKPEADKASKLASRPKNSKEKK
KTVPCNRGEITEEAKYVADLGGSSGKTTNVVEETSKIETYIAKPALPGTSTNSNVAPLCQITVKIGNEAIVKRHILGSKLFYKRGRKPKYQMQEETLPRESDPETRGDSP
LGLCQADCVEMSEAFDEVSDQDSTDKPWRPYYNYKPKKKSKQLRKIRKVKWRKERGSRSPVGRRRYPAELDRAEMGRRRYPAELDRCAEVKLPPDKASEEEENKEMPKLQ
CELCDGDKAAGAGAEGKPHQHLTLKPYICELCAKQFQSSSTLKMHMRCHTGEKPYQCKTCGRRFSVQGNLQKHERIHLGVKEFICQYCNKAFTLNETLKIHERIHTGEKR
YHCQFCFQGFLYLSTKRNHERRHVREHDGKGFACFQCPKICKTAAALRMHQKKHLFKTLTKQEETDDLCHENSDLLESQPCTDSEDSDQKDDIKKPLLKMSFE*
9 >lcl|NP_001012763.1|Plus1complement(6080320..6081033) NW_047696 zinc finger protein 422 Zfp422 __SEG__ Chr4 {Rattus norvegicus} MRLGKPKGGISRSASQGKTYESKRKTARQRQKWGVAIRFDSGLSRRRRNVDEKPYKCTKCSKSFSQSSTLFQHKKIHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKP
YKCDECGERFKQSSNLIQHQRIHTGEKPYCCDECGRCFSQSSHLIQHQRTHTGEKPYQCEECDKCFSQSSHLRQHMKVHKEKKSHKRGKNARAKTHPVSWKRGKGRKAVA
GLRQVKGAASGLFKKKK*
10 >lcl|NP_001014054.1|Plus115796011..15797126 NW_047601 male-specific lethal 3-like 2 Msl3l2 __SEG__ Chr20 {Rattus norvegicus} MATLGCAPKDDGEGKDEGGSDRGDGDPKPKGKKEVEAHTRREADERAVRIPIPEVLQQRLADDCYYINRRRRLVRLPCQTNVGAILECYVRHFSASALASGDRRPQPQRA
APERSVGLCREMADGLRITFDHALPLVLLYPQEQAQYEMVTSSTFFFPTEERASDAGRSQEAPWPGPSPPQPSESQAMAGPTAPKRRRVETDAARAPRRSTRHSTHCHWQ
AEDRASPQAKRSVPKLFPHLQKTPVHSTALSPIALTPGKEGSAMFAGFEGTTEEINEILSWKLVPDNYPPGHQPPPPSYIYGAQHLLRLFVKLPEILGKMSFSEKNLKAL
LKHLDLFLRFLAEYQADFFLESAYVSACEAHYSSKNPRTIC*
11 >lcl|NP_001014287.1|Plus120722169..20723326 NW_047773 MTERF domain containing 3 precursor Mterfd3 __SEG__ Chr7 {Rattus norvegicus} MSWRLLTGYQLCRLRLFRKPQPALKIRPSSVCVTYGTDCQSNKENKRTVETLRACSVDIGKICRLKGWVLLEEETYAEEIANILKELGANQTVIASILERCPEAIVCSPA
AVNTKRKLWQMVCKTKTELIQLIEQFPESFFAVKDQENQKLNVQFFQELGLKNVVITRFLTTASSIFHNPVENNKQMIGVLLESYLNLGGSEANAKVWLLKLLSQNPFIV
LSSPTAVGEVLKFLQGQGFTDSEVLQLLSKLKGFLFQLQPGSIQNSISFTKTTFECTDHDLRQLVVKCPALLYYPAPVLEERIQALLKEGISVAQIRASPMVLELTPQII
QYRIRKLNSLGYGIKDGHLASLNGTKKEFEANFSKMQAKQGRPLFNPVASLKVEE*
12 >lcl|NP_001017503.1|Plus1complement(4261071..4262024) NW_047430 purine rich element binding protein B Purb __SEG__ Chr14 {Rattus norvegicus} MADGDSGSERGGGGGGPGSFQPAPRGGGGPGGEQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQL
AAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTVNRGGGGFGGGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDELAGGPGGGAGGPGGGL
YGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMKEIQERQRDKLYERRGGGSGGGDESEGEEVDED*
13 >lcl|NP_001019429.1|Plus13810446..3813142 NW_047556 zinc finger protein 574 Znf574 __SEG__ Chr1 {Rattus norvegicus} MTEESEETVLYIEHRYVCSECNQLYGSLEEVLVHQNSHVPQQHFELVGVADPGVTVATEATSGTGLYQTLIQESQYQCLECGQLLLSPSQLLEHQELHLKMMAPQEAVPA
EPPPKVPPLSSSTIHYECVDCKALFASQEMWLSHRQTHLRATPNKAPAPVVLGSPVVLGPPVGQARVAVEHSYRKAEEGGEGAAVPSVAAATEMVTEVELLLYKCSECSQ
LFQMPADFLEHQATHFPAPVPEAEEPATQQETLVPSPTEAAVSQPDPLPASDHSYELRNELRNGEAMGRDRRGRKPRRSSSGESGATQELFCSACDQIFLSPHQLQQHLR
SHREGVFKCPLCSRVFPSPSSLDQHLGDHSSESHFLCVDCGLAFGTEALLLAHRRAHTPNPLHSCPCGKTFVNLTKFLYHRRTHGAGGVPLPTTPVPPEEPAISFPEPAP
AETGELEAPELPVSEESSAEPAAPGTYRCLLCSREFSKALQLTRHQRFVHRLERRHKCSICGKMFKKKSHVRNHLRTHTGERPFPCPDCSKPFNSPANLARHRLTHTGER
PYRCGDCGKAFTQSSTLRQHRLVHAQHFPYRCQECGVRFHRPYRLLMHRYHHTGEYPYKCRECPRSFLLRRLLEVHQLVVHAGRQPPPLPVPVGLPSPRHYGFVSIAVRL
LPPRPHGALSVAPAARKWALLLACRHMKLPTLLQVLERSWLRSLRLPGPQGPLAHQLLPLQQPLVVQPLLPLQPLPGAGVWNAVSARSSSARRHHCRSIGASTQASGHTR
AQTVARPSARVPI*KTTGACTQASGPLLAKCVARPLPSPCAWQNIDASTRVNDPTPALTVARATAPSPISGNTARLTSSSIRQQCGSSWQRPRLLWAWL*WKLQWRLCPL
WRPLRSTL*LKRMGSRSVA
14 >lcl|NP_001020212.1|Plus1complement(9516113..9517342) NW_047651 immediate early response 5-like Ier5l __SEG__ Chr3 {Rattus norvegicus} MECALDAQSLISISLRKIHSSRTQRGGIKLHKNLLVSYVLRNARQLYLSERYAELYRRQQQQQQQQQQPPHHQHQHLAYAAPGMPASAADFGPLQLGGGGDAEAREPVAR
HQLHQLHQLHQLHLQQQLHQHQHPAPRGCTAAAPVAVAGAPAGCAGALSELPGCAALQPPHGAPHRGQHLEPLQPGPAPLPPPAPAALCPRDPRVPAACSAPSAPPGAAP
PTVAASSPPASPAPSSSPGFYRGAYPAPSDFGVHCSSQTTVLDLDTHVVTTVENGYLHQDCCASAHCPCCGQGAPGPGLASAAGCKRKYYPGQEEEDDEEEDAGDLGAEP
PGGTPFAPCKRARFEDFCPDSSPDASNISNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVAF*
15 >lcl|NP_001020848.1|Plus1complement(10419504..10420334) NW_047555 hypothetical protein LOC308318 RGD1308782 __SEG__ Chr1 {Rattus norvegicus} MLCCAETPLLSTDNVTILQTSSSLLRHQVTYTAGDTPMNTESGEAIQSEKKNCICSDCGKTFTSTSHLNRHRMIHTGEKPFQCSECGMSFSQKAFLIKHFRIHTGEKPFR
CGECGKAFKHNISLVSHQRVHTGETPFTCTECGKSYMTRSNLTRHFQVHASEKPYSCSECGKAFKEKSSLIYHARVHTRERPFQCSDCGKSFSQKAFLIKHFRVHTGEKP
FRCSECGKAFKHNCFLVAHQRVHTGETPFTCTECGKSYMNRSSLLYHYRVHTGEKP*
16 >lcl|NP_001032721.1|Plus1complement(319742..320974) NW_047785 Sp7 transcription factor isoform 1 Sp7 __SEG__ Chr7 {Rattus norvegicus} MLTAACSKFGGSSPLRDSTALGKGGTKKPYTDLSAPKTMGDAYPAPFSSTNGLLSPAGSPPAPASGYANDYPPFPHSFPGPTGAQDPGLLVPKGHSSSDCLPSVYTSLDM
SHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQGTLSTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSGQLE
GSGAGKPPRGAGTGGSGGYAGSGAGRSTCDCPNCQELERLGAAAAGLRKKPIHSCHIPGCGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTHTRE
KKFTCLLCSKRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSVGEEEANQPPRSSTSPAPPEKAPGGSPEQSNLLEI*
17 >lcl|NP_001073849.1|Plus1complement(42972446..42973507) NW_047760 transmembrane protein 30B Tmem30b __SEG__ Chr6 {Rattus norvegicus} MTWSASARGAQQPDNTAFTQQRLPAWQPLLSAGITLPLFFCAGLAFIGLGLGLFYSSNGIQELEYDYTGNPGTGNCSVCAAKGQDRAPPPSCQCSWSFTLPELFPGPVYL
YYELSNFYQNNRRYGVSRDDAQLSGLASALRHPANECAPYQFSSDGLPIAPCGAIANSLFNDSFSLWHQRQPADPFVEVPLDRTAIAWWTDYHVKFRNPPLVNGSLALAF
KGTAPPPNWHRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGTYRVNITYNYPVRAFGGHKLIILSNISWMGGKNPFLGIAYLVVGSLCIL
MGFVMLVVYIRYQDQDDDDNDDE*
18 >lcl|NP_001075220.1|Plus1366934..367941 NW_047616 POU domain class 5, transcription factor 2 Pou5f2 __SEG__ Chr2 {Rattus norvegicus} MAGRRSSNVCPFPGNSGGGLEGPVPMRVDTPTWLSSQAATSRLMVRPGMGPGFCPGPEVWGVPLGPSPYEFRGGIAPYGAYETRTWSQNSSEDTYPGPYIALRYMPNLAL
PEDVSAIQKEMEQLAKELRQKRMTLGYSQADVGFAVGAMFGKVLSQTTICRFEAQQLSLANMWKLRPLLKMWLEEVDEKNLLGICRMEMILQQARKRRRASRERRIGSNL
EKLFLQCPEPTPQQISYIAGRLRLQKDLVQVWFSNRSQMAGWPTNDSSQRENVGATGAPFPGPPVCFPLAPGLHFDFPHYGGSCLTPLYSSTPFPVRGALLSAPTTTLGL
PRLSS*
19 >lcl|NP_001094027.1|Plus131206445..31207416 NW_047354 oligodendrocyte lineage transcription factor 2 Olig2 __SEG__ Chr11 {Rattus norvegicus} MDSDASLVSSRPSSPEPDDLFLPARSKGGSSSGFTGGTVSSSTPSDCPPELSSELRGAMGTAGAHPGDKLGGGGFKSSSSSTSSSTSSAATSSTKKDKKQMTEPELQQLR
LKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSTPLPTATAHPAAAAHAAHHPAVHHP
ILPPAAAAAAAAAAAAAVSSASLPGSGLSSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGGSGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGTLPRLTSDAK*
20 >lcl|NP_001099412.1|Plus1complement(8537195..8538187) NW_047773 neurogenic differentiation 4 Neurod4 __SEG__ Chr7 {Rattus norvegicus} MAKMYMKSKDMVELVNTQSWMDKGLSSQNEMEEQERRPGSYGMLGTLMEEHDSIEEEEEEEEDGDKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNL
RRVMPCYSKTQKLSKIETLRLARNYIWALSEVLETGQTLEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQSALLEKREEKSPICDSTVSVHSFNYQSPGLPSPPYGHMETH
PLHLKPQPFKSLGDSFGSHPPDCSTPPYEGPLTPPLSISGNFSLKQEGSPDLEKSYNFMPHYTSASVSSGHVHSTPFQTGTPRYDVPVDLTYDSYPHHGIGTQINTIFSD
*
21 >lcl|NP_001099440.1|Plus1complement(5338646..5339047) NW_047399 nescient helix loop helix 1 Nhlh1 __SEG__ Chr13 {Rattus norvegicus} MMLNSDTMELDLPPTHSETESGFSDCGGGPGPDGAGSGDPGVGQVRSLELGESGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKK
LSKIEILRLAICYISYLNHVLDV*
22 >lcl|NP_001099523.1|Plus150920253..50921077 NW_047454 hypothetical protein LOC290425 RGD1306441 __SEG__ Chr15 {Rattus norvegicus} MNISGSKQIHKRKILRLFSCFSCTQNQKKLKHKSQDVEKKLCRENKVLRDENRALRKDNKFLWGENKALGRENKTFRMDNQFIRERNHILRQQNQLLRKVKRLISENPKL
SGEECNALNTEGRSFWQQNRAMEAQITALRQQEKAFQNEAKALHEEIKSLCEETKALQHQERALRMEEKALLRDGVAAELAEALTKEGAALEMEEQALWKEEQALREENK
ALREEHGALQDEEVALQEEARILQEWNNLLQGKITNNLPENMNNQDPEKCELRM*
23 >lcl|NP_001099739.1|Plus114568531..14569352 NW_047544 oligodendrocyte transcription factor 3 Olig3 __SEG__ Chr1 {Rattus norvegicus} MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHHQESRLNSVSSTQGDMVQKMPGESLSRAGAKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREV
MPYAHGPSVRKLSKIATLLLARNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANAVHPVHPILGGALSSGNASSPLSAASLPTIGTIRPPHSLLKAP
STPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK*
24 >lcl|NP_001099854.1|Plus1complement(5148706..5150304) NW_047598 zinc finger protein 280b Zfp280b __SEG__ Chr20 {Rattus norvegicus} MEQPYVVDDDESDPEPQPRSQEPIQVLDEDDSEDAELIFVGVENVKEDAELIFVGVTSTSQPANSNILNRVTPGSRLKRKHDRLRETTTQRLQPSPPAAPTSEAAIVLPV
SPAESRSTDSPIIIEPLSESDYKSNSQVVPSSSSKCCSPLATLSSSESGPARAACSGGGLNESLYVSKCHFSINPQRPERSIEIVEELSSALPPSGPFHTSNAQQRTPSL
EAPKSLNLFVNGAPLSGDPVHPRQDSGSVDTDFSSLASPETFDPKKGSLTLLLSDFYYGQYKGEGKPEQKTHTTFKCPSCSKALKNVKFMNHTKHHLELERQGSDEAWES
HTTCLRCHRLFASPFQLECHIDRVHTAPDPCVVCKICELSFETEQVLLEHMKDNHKPGEMPYVCQVCKYRSSVFADVETHFTKCHVNTKNLLCPFCLKIFRTGMPYMCHC
RGHWERNGHQCSKCRLQFLTFKEKMEHKTQCHQMFRKPKQLEGLPPETKVVIQVSVKPVEAESVEVASITVSTTDWEPSCPRSQGRLSQKPH*
25 >lcl|NP_001099927.1|Plus15347481..5347888 NW_047627 nescient helix loop helix 2 Nhlh2 __SEG__ Chr2 {Rattus norvegicus} MMLSPDQAADSDHPSSTHSDPESLGGVDTKVLGSVSDLEPVEEVDGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPD
KKLSKIEILRLAICYISYLNHVLDV*
26 >lcl|NP_001099936.1|Plus1complement(14159247..14160374) NW_047627 protein arginine methyltransferase 6 Prmt6 __SEG__ Chr2 {Rattus norvegicus} MSLSKKRKLESGVGGAGGEGAEEENGGEQEAAPPRPRRTKRERDQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYA
VEASAIWQQAQEVVRLNGLEDRVHILPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPDSAELFVAPISDQMLEWRLGFWSQVKQHYGVDMS
CMESFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELARAGLEQELEAGVGGRFRCSCYGSAPLHGFAIWFQVTFPGGDSEKPLVLSTSPFHPATHWKQALLYLNEPVP
VEQDTDISGEITLLPSRDNPRRLRVLLRYKVGDHEEKTKDFAMED*
27 >lcl|NP_001100161.1|Plus12329449..2330630 NW_047725 zinc finger protein 46 Zfp46 __SEG__ Chr5 {Rattus norvegicus} MSEEPLENAEKNPGSEEAFESGDRSERPWGDLTAEEWVSYPLQQVTDLLVHKEAHTGIRYHICSQCGKAFSQISDLNRHQKTHTGDRPYKCYECGKGFSRSSHLIQHQRT
HTGERPYDCNECGKSFGRSSHLIQHQTIHTGEKPHKCTECGKSFCRLSHLIQHQRTHSGEKPYECEECGKSFSRSSHLAQHQRTHTGEKPYECNECGRGFSERSDLIKHY
RVHTGERPYKCDECGKNFSQNSDLVRHRRAHTGEKPYHCNECGENFSRISHLVQHQRTHTGEKPYECTACGKSFSRSSHLITHQKIHTGEKPYECTECWRSFGERSDLIK
HQRTHTGEKPYECVQCGKGFTQSSNLITHQRVHTGEKPYECTECDKSFSRSSALIKHKRVHTD*
28 >lcl|NP_001100273.1|Plus113231011..13231571 NW_047798 methyl-CpG binding domain protein 3-like 1 Mbd3l1 __SEG__ Chr8 {Rattus norvegicus} MGKTSQRKQCDCENPSKPCLSTSIPLRMSNYTFKRPVTKITSHLGNEVRYYQWEETLEKPEQACWQKRLQGLQAYSSAGEILSTSDLSKALKDLTPRDTDAASSIIQANS
MDPRPLSTLGSSSHLAKMIPEAGPQILCKEFLVTEEDISIQERKVKIARERLAVALIAHKLANETEKVRGSRKAKV*
29 >lcl|NP_001100320.1|Plus1complement(3974723..3975445) NW_047801 SRY (sex determining region Y)-box 14 Sox14 __SEG__ Chr8 {Rattus norvegicus} MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGL
PVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATSALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSASTLQPPVAYIL
FPGMTKTGIDPYSSAHATAM*
30 >lcl|NP_001100864.1|Plus1complement(2125391..2126416) NW_047511 TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa Taf7 __SEG__ Chr18 {Rattus norvegicus} MSKSKDDAPHELESQFILRLPPEYAATVRRAVQSGHVNLKDRLSIELHPDGRHGIVRVDRVPLAAKLVDLPCVTESLKTIDKKTFYKTADISQMLVATVDGDLYPPVEEP
AATADPKANKKKDKDKEKKFVWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELR
EIFNDLSSSSEDEEDVNIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSS
LQEELESLLEK*
31 >lcl|NP_001100892.1|Plus17258472..7259398 NW_047535 THAP domain containing 11 Thap11 __SEG__ Chr19 {Rattus norvegicus} MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQ
QQQQQQQQQQQQQQQQQSPSSSTAQTAQLQPNLVSASAAVLLTLQAAVDSSQAPGTVVPAPTTSSGDDVKPIDLTVQVEFAAAEGAAAAAAASELEAATAGLEAAECTLG
PQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRLLAMAVIRKKHGM*
32 >lcl|NP_001100947.1|Plus1complement(18017724..18019355) NW_047555 zinc finger protein 329 Zfp329 __SEG__ Chr1 {Rattus norvegicus} MRLKIIAQNVPEEESVSFEVEMEGFTREGPCFPILGDNWDCENQERNSRQSPLIDEKTEAQEANCDHHNLGEHLSTNPALLASQRVPTTNSFHVPNSDIKTFDCDQTLHS
CPQNYTFKGTGDDDACEKAIHPSMEVTQLVRNQTRDKPYKYAESIKSINHFTTALCDKKIKKRSKKFYKGKDFGDILALSSSLNEKRNHSTEKPYKCAECGKCFKRNSSL
VLHHRTHTGEKPYTCNDCGKSFSKNYNLIVHRRIHTGEKPYKCSKCGKAFSDGSALTQHQRIHTGEKPYACLDCGKTFNRNSSLILHQRTHTGEKPYRCNECGKPFTDIS
HLTVHLRIHTGEKPYECSRCGKAFRDGSYLTQHERTHTGEKPFECVECGKSFNRNSHLIVHQKIHSGEKPYECKECGKTFIESAYLIRHQRIHTGEKPYGCNQCRKLFRN
IAGLIRHQRIHTGERPYECNQCGKAFRDSSCLTKHQRIHTKETPYQCLKCGKSFRQNTHLVVHQRLHNREGPSQCPHCGKIFRRSWCLARHQRTHLEEQPTET*
33 >lcl|NP_001101438.1|Plus1complement(913048..913899) NW_047719 zinc finger protein 691 Znf691 __SEG__ Chr5 {Rattus norvegicus} MGSEKEQSPGAHLPEEGEGAKPWRVDDSKDSQTTSGEEHGQESLLEGLHEQHSQKPWRKVTTQAGGPGDPMTFSSPETDEKPFTCAQCGKAFNNTSNLRTHQRIHTGEKP
YKCSECGKSFSRSSNRIRHERIHLEEKHYQCARCQESFRRRSDLTTHQQDHLGQRPYRCDICGKSFSQSSTLAVHHRTHLEPAPYICCECGKSFSNSSSFGVHHRTHTGE
RPYECTECGRTFSDISNFGAHQRTHRGERPYRCTLCGKHFSRSSNLIRHQKTHLGEQDEKDSS*
34 >lcl|NP_001102303.1|Plus11120109..1121239 NW_047338 Sp6 transcription factor Sp6 __SEG__ Chr10 {Rattus norvegicus} MLTAVCGSLGSQHTDAPHSSPPRLDLQPLQTYQGHTSPEAGDYPSPLQPGELQSLPLGPEVDFSQGYELPGASSRVTCEDLESDSPLAPGPFSKLLQPDMSHHYESWFRP
THPGTEDGSWWDLHPGTSWMDLPHTQGALTSPGHPGALQPALGGYVGDHQLCAPPPHPHPHHLLPAAGGQHLLGPPDGAKVLEAAAPESQGLDSSLDAAARPKGSRRSVP
RSSGQTVCRCPNCLEAERLGAPCGPDGGKKKHLHNCHIPGCGKAYAKTSHLKAHLRWHSGDRPFVCNWLFCGKRFTRSDELQRHLQTHTGTKKFPCAVCSRVFMRSDHLA
KHMKTHEGAKEEAAAAAQGEGKAGGVVESPGGKGKREAEGSSASSN*
35 >lcl|NP_001102375.1|Plus1complement(12881837..12882781) NW_047555 zinc finger protein 524 Znf524 __SEG__ Chr1 {Rattus norvegicus} MDNPSSDPLPSTLSGEEEKPLALLPPVPRGRRGRPPGAATTSNRTLKSSLPRKRGRPPRSVQETPLTAAVDSSGSSDLLLIDDQGVPYTVPEGSAADGPQGSGSKRAPHF
CPVCLRAFPYLSDLERHSISHSELKPHVCKDCGKTFKRSSHLRRHCNIHAGLRPFRCVLCPRRFREAGELAHHHRIHSGERPYQCPSCRVRFTEANTLRRHYKRKHPELV
GMPVRLCPPNPRPQPLWDDDEGVPVQEGVQEESPEGKEPAWPISSTSPLSGCTAGGSAGAGHGQEGQDTLVSGGIPAVEGDQKQGPKPLDSDAI*
36 >lcl|NP_001102410.1|Plus18072326..8073384 NW_047624 basic helix-loop-helix family, member e22 Bhlhe22 __SEG__ Chr2 {Rattus norvegicus} MERGLHLGAAAASEDDLFLHKSLGASAAKRLEAAFRSTPPGMDLSLAPPTRERPASSSSPLGCFEPADPEGAGLLLPPPGGGGGASGGGVSVPGLLVGSAGVGGEPSLSS
LPAGAALCLKYGESAGRGSVAESSGGEHSPDDDSDGRCELVLRAGGPDPRASPGAGSGGAKVAEGCSNAHLHGGSGLPPGGPTSGSGGNGGGGSSKKSKEQKALRLNINA
RERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALEEMRRLVAYLNQGQAISAASLPSSAAAAAAAAALHPALGAYEQAAGYPFSAGLPPAASC
PEKCALFNSVSSSLCKQCTEKP*
37 >lcl|NP_001102423.1|Plus1complement(3221458..3222729) NW_047653 zinc finger and BTB domain containing 6 Zbtb6 __SEG__ Chr3 {Rattus norvegicus} MAAESEVLHFQFEQQGDVVLQKMNLLRQQNLFCDVSIYINDTEFQGHKVILAACSTFMRDQFLLTQSKHIRITILQSAEVGRKLLLSCYTGALEVKRKELLKYLTAASYL
QMVHIVEKCTEALSKYLEIDLSMKNNQHTDLCQSSDTDVKNEEENSDKDCEIIEISEDSPVNLDPPVKEEEGDALQSAAETLTSERRGVKSPELSTVDGGFKENEICILH
VESIHTDDIENGQFPQPCTSSNAGMYFPETQHSVINSTVENRVTEVPGNTNQGLFSENSDGSHGTINEIQNLDENFSLRHQCPRCPRGFLHVENYLRHLKMHKLFLCLQC
GKTFTQKKNLNRHIRGHMGIRPFQCTVCLKTFTAKSTLQDHLNIHSGDRPYKCHCCDMDFKHKSALKKHLTSVHGRSSGEKLSRPDLKCQNLL*
38 >lcl|NP_001102450.1|Plus14697711..4698211 NW_047759 Fer3-like Ferd3l __SEG__ Chr6 {Rattus norvegicus} MAAYPESCLDANVLNFVADLSLASPRHPFLCEFPPGVPFEDQTLGFREGRGLLQFEGRYQEVEGGEVDYEDPEEEEEEGEGRGRVASLLGRPKRKRVITYAQRQAANIRE
RKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLQSKEEKEAS*
39 >lcl|NP_001102485.1|Plus1711176..712252 NW_048040 hypothetical protein LOC367782 LOC367782 __SEG__ ChrX {Rattus norvegicus} MSDKNQIIARASLIEQLVSKRYFEDIGKQLTELEMIYVSKEHLQETDVVRAVYRVLKNCPSVTLKKKAKCLLAKWRGFYKNTHFKTRESLKVLHTDVNKEVSVAVSQDES
QDETPGSSHNEILGLCSSLSRLSPQDAAKAAAAFGSESSAAQMEINEGYLEDDSESPSKSSGVLDNPLVSVRSKCIELLYKALASSCTDHTKVHFWQNLARQIEEHIFTL
HSNDIKKYKNNIRSKVANLNNPRNSHLQQNLLSGTISAREFAEMTVLDMANQELKQLRASYIESSIQEHHLPQIVDGTHTNKIKCRRCDKYNCTVTVIARGTLFLPSWVQ
NSNPDEQMTYVICNECGEQWYHNDWVCL*
40 >lcl|NP_001102504.1|Plus144488491..44490002 NW_047334 zinc finger protein 3 Zfp3 __SEG__ Chr10 {Rattus norvegicus} MGTEEKEVLPKEDISQDCESHGPTLEKLAQEVYQGHEFGAASEEDILEGHLRESSQEIIEQMYPQERDFASGLIIFKRSSSGEKDQKHRESPRGFSPNTSVLMCHGDATA
ERVSTCAASGQNFMESIELTKAQRTPVGEKPHTCKECGKTFNQNSHLIQHMRVHSGEKPFECKECGKTFGTNSSLRRHQRIHAGEKPFACTECGKAFIQSSHLIHHHRIH
TGERPYKCEECGKAFSQNSALILHQRIHTGEKPYECNECRKTFRVSSQLIQHQRIHTEERYHECSECGKAFKHSSGLIRHQKIHTGEKPYLCNECGKGFGQSSELIRHQR
IHTGDKPYECSECGKTFGQNSEIIRHIRIHTGEKPYVCKECGKAFRGNSELLRHERIHTGEKPYECFECGKAFRRTSHLIVHQRIHTGEKPHQCNACARTFWDNSELLLH
QKIHIGEKPYECSECEKTFSQHSQLTIHQRTHTGEKPYECQECQKTFSRSSHLLRHQSVHCSE*
41 >lcl|NP_001102651.1|Plus17326554..7327513 NW_047625 SRY (sex determining region Y)-box 2 Sox2 __SEG__ Chr2 {Rattus norvegicus} MYNMMETELKPPGPQQASGGGGGGGNATAAATGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDY
KYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQEQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMN
GSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMAQHYQSGPVPGTAINGTLPLSHM*
42 >lcl|NP_001102681.1|Plus1complement(388631..389302) NW_047667 basic helix-loop-helix family, member e23 Bhlhe23 __SEG__ Chr3 {Rattus norvegicus} MAELKSLSGDSYLALSHGYAATSHAYAAARGPETTRGFGASGPGGDLPAAPASRVPAATVESSGEQSGDEDEAFERRRRRRGPGVAVDARRRPREQRSLRLSINARERRR
MHDLNDALDGLRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALEEMRRLVAYLNQGQSLAAPVAAAPLTPFGQAAVYPFTAGAALGPCPDKCATFSGSPSALCKHCG
EKP*
43 >lcl|NP_001102707.1|Plus1complement(2772600..2773613) NW_047693 neurogenic differentiation 6 Neurod6 __SEG__ Chr4 {Rattus norvegicus} MLTLPFDESVVMPESQMCRKFARQCEDQKQIKKPESFPKQVVLRGKSIKRAPGEETEKEEEEEDREEEDENGLPRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGL
NDALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGCLQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELATPP
GHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFPYDLHLRSQSLTMQDE
LNAVFHN*
44 >lcl|NP_001102708.1|Plus112405593..12406648 NW_047693 atonal homolog 1 Atoh1 __SEG__ Chr4 {Rattus norvegicus} MSRLLHAEEWAEVKELGDHHRHPQPHHIPQLTPQPPATLQARDHPVYPAELSLLDSTDPRAWLTPTLQGLCTARAAQYLLHSPELGASEAAAPGDEADGQGELVRRSGCG
GLSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSVGEQ
PPPPAASCKNDHHHLRAAASYEGGAGASAVAGAQPAPGGGPRPTPPGACRTRFSTPASSGGYSVQLDALHFPAFEDRALTAMMAQKDLSPSLPGGILQPVPEDSSKTSPR
SHRSDGEFSPHSHYSDSDEAS*
45 >lcl|NP_001102827.1|Plus11462505..1464184 NW_047716 zinc finger protein 352 Zfp352 __SEG__ Chr5 {Rattus norvegicus} MDMAETPGASQTVPCNTQPSPVESSQLVSGQSSEMPTWKQTVMASSYFNPYETACTQNSTAHRGKATDSYFGEPSETASFIQQVVSAEQNKSPEGSLFMKLNSTATSCLP
QPLDTRKTLYNEGYWRRTLNSDKTLLIQNTDLCESQRITFGNHPVALSGSHAGQVPNVDHLDSVWDQTFGGDLEMPFSDDSYYSQMTTKYGGHLTLYESQMIAPSCNQVL
DTDQFVTSFYEQNPFGDQQRSPVTENKFYGDQMIVPNAYQAFYEPQVRDNSDQINFDSRMASFSGQNICSGQESIFQDEHSLSGFQTSGYRCDQDWIMNHQVISPIGGQT
LYDSQKPTSTFNTTPHGSKRTTSSAEDNLAWHPETSSSSEETLYMGQMRASVDQNVYASQNGTANTEESLEPEVTSLSNQAPDVGESSDSSSSPLIRIQSQGISSASGLD
QGQHPQIRLDLKTQSPVSPEKPPTLKRYSCTYQGCEKSYTKSHHLKDHMRKHTGEKPFVCDQIGCNWKFFRSIDLNRHKKKHSGERPYACPKCNKNYSRPYYLKQHQVSH
IQALPTTAN*
46 >lcl|NP_001102843.1|Plus1complement(379842..380486) NW_047537 high mobility group box 1 like Hmg1l1 __SEG__ Chr19 {Rattus norvegicus} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYR
PKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIPAYRAKGKPDAAKKGVVKAEKSKKKKEEEDNEEDEEDEEEEEEEEDEDEEDDDDE*
47 >lcl|NP_001102894.1|Plus1complement(28774979..28775266) NW_047354 keratin associated protein 16-5 Krtap16-5 __SEG__ Chr11 {Rattus norvegicus} MSYYGSYYGGLGYGYGGFGGLNCGCSSIRRLGYGSGFGGFGYGSGFGGYGYGSGFGGYGYGSGFRGYGYGSGFGGYGYGCRRPSHYGGYGFSSFY*
48 >lcl|NP_001102932.1|Plus18193819..8194145 NW_047713 T-cell acute lymphocytic leukemia 2 Tal2 __SEG__ Chr5 {Rattus norvegicus} MTRKIFTNTRERWRQQSVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGIAAQGNILGLFPHKPHLPDVGESSLLNGYRVSSPGPSHGAP*
49 >lcl|NP_001103097.1|Plus1complement(1754478..1755593) NW_047338 hypothetical protein LOC691153 LOC691153 __SEG__ Chr10 {Rattus norvegicus} METLCPPPRLAVPASPRGSPCSPTPRKPRRGTPEFSPLCLRALAFCALAKPRPSSLGLGPGELAPRTPVLLGSRASPCTGGWAADGLKHLGAQAGRPSDVSSATREDADV
AVCPDRGEEEEGGGGFPHFGSGSCTPPGRCPAGPRESPTSPARSPPRPARGLESQLDAASSPPLGSSSRPPSPPAGLSPEPAPTEQPMRDSEAPEGGDPARVAPEAPALS
PSTADATPDAPGDLRQEHFNRLIRRSKLWCYAKGFALDTPSLRRGPERPAAKARGAAKKRRRPAPPPRSVQPRRPAPTLPTSSTFHLLDCFPCPPALVVEENGDLGPASS
LRLQGDAKPPPAHPLWKWQMGGPAVPEPPGLKSWWVNLEEL*
50 >lcl|NP_001119748.1|Plus112905657..12907345 NW_047555 zinc finger protein 579 Znf579 __SEG__ Chr1 {Rattus norvegicus} MDPQPPPPAQGSPPHRDRGRGRGRGRGRGRGRGRGRGGAGAPRAPLPCPTCGRLFRFPYYLSRHRLSHSGLRPHACPLCPKAFRRPAHLSRHLRGHGPQPPLRCAACPRT
FPEPAQLRRHLAQEHAGGEMDLTTQRAVKEEPEASWGPQDEGVEQPSTVVVAGVAEEATAQWPAGDPASVAAPTSTDPRESEAEEAEAGAAELRAELALAAGRQEEKQVL
LQADWTLLCLRCREAFATKGELKAHPCLRPEGEQEGEGGPPPRPKRHQCSICLKAFARPWSLSRHRLVHSTDRPFVCPDCGLAFRLASYLRQHRRVHGPLSLLAPLPGAS
KKDDKASGGRNSGKGPEGVEGAECGGASEGGEGGQNGGDATPARPPAGEPRFWCPECGKGFRRRAHLRQHGVTHSGARPFQCVRCQREFKRLADLARHAQVHAGGPAPHP
CPRCPRRFSRAYSLLRHQRCHRAELERAELERAAALQALQTQAIQSSQPPQPFKQEAEGLPLPISHIKEEPPSPGTPPQSPPAPPVFLSASCFDSQDHSAFEMEDEEVDS
KAHLCGLGDLAS*
51 >lcl|NP_001121030.1|Plus1complement(23288768..23290153) NW_047334 zinc finger protein 2 Zfp2 __SEG__ Chr10 {Rattus norvegicus} MDREDLWHSALGAVWDSTCWLEEQQERYLGQVTVTQKEIFNEKRVCGGNKTENGSIEHSMLSIPQSIPVTIRLCNWNSYGKGSNQNPKLMKSSRMFVRKKIYECDECGKS
FSQSSSLLKHQRIHTGEKPYKCNVCDKHFIERSSLTVHQRTHTGEKPYKCNECGKAFSQSMNLTVHQRTHTGEKPYQCKECGKAFRKNSSLIQHERIHTGEKPYKCNDCG
KAFTQSMNLTVHQRTHTGEKPYECNQCGKAFSQSMHLIVHQRSHTGEKPYECSECGKAFSKSSTLTLHQRNHTGEKPYKCNKCGKSFSQSTYLIEHQRLHSGVKPFECNQ
CGKAFSKNSSLTQHRRIHTGEKPYQCMVCGKHFTGRSSLTVHQVIHTGEKPYECTECGKAFSQSAYLIEHQRIHTGEKPYECDQCGKAFIKNSSLIVHQRIHTGEKPYKC
NECGKSFSRSTNLTRHQRTHT*
52 >lcl|NP_001128556.1|Plus12331579..2332778 NW_047492 zinc finger protein 322a Zfp322a __SEG__ Chr17 {Rattus norvegicus} MYTSEEKCNQRTQKRKIHHVCPQKGKKIYIRVHEITQIDNQIYQCLEREQNFCENLAQMCERTYTGEKPYRCDMCEKTFIQSSDLISHQRIHNYEKPYKCSKCEKSFWHH
LALSGHQRTHAGKKFYTCDICGKNFGQSSDLLVHQRSHTGEKPYLCNECDKCFSRSTNLIRHRRTHTGEKPFKCLECEKAFSGKSDLISHQRTHTGERPYKCNKCEKSYR
HRSAFIVHKRVHTGEKPYKCSACEKCFGQKSDLIVHQRIHTGEKPYKCLECMRSFTRSANLIRHQATHTHTFKCLEYEKSFNSSSDFIVHQRIHMEEKPHQWSMCESGFL
LGMDFVAQQKMRTQTEELHYKYGACNKSFHHSSALLQHQTVHIDDEYICNMSEKGLDLSSHASETSRMS*
53 >lcl|NP_001128566.1|Plus1complement(28491828..28492793) NW_047689 Kruppel-like factor 14 Klf14 __SEG__ Chr4 {Rattus norvegicus} MSASVACLDYFAAECLVSMSTRAVLHRRATDSEGAGAAAVSEVGEVSRESAGKGTGSRGVLWIPPVLEVPAPSPGEGDGAPHLLAASALADLSCGAREGTKEDSEEAPCA
STSCFEPTQCSSPTGCSEPTQTFGEDELSDAESSCSESAILGAPEVPEEPDDSGEVPEGPPGARPGPAVGPTYRRRQITPASKRHQCSFHGCNKAYYKSSHLKSHQRTHT
GERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTYHPDMIEYRGRRRTPRPEPPPPAMVESSGSDSGQETSFTACP*
54 >lcl|NP_001153125.1|Plus11531306..1532076 NW_047663 GNAS complex locus NESP55 NESP55 Gnas __SEG__ Chr3 {Rattus norvegicus} MDRRSRAHQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALASSNARAQQRAAQRRSFLNAHHRSAAAAAAAQVLPESSESESDHEHEEAEPELARPECLEYDQDD
YETETDSETEPESDIQSETEFETEPETEPETAPTTEPETEPEDERGPRGATFNQSLTQRLHALKLQSADASPRRAQPTTQEPESASEGEEPQREPLDEDPRDPEESEELR
EANRQPRRCKTRRPARRRDQSPESPPRKGPIPIRRH*
55 >lcl|NP_001162056.1|Plus1complement(28852893..28854170) NW_047563 forkhead box B2 Foxb2 __SEG__ Chr1 {Rattus norvegicus} MPRPGKSSYSDQKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPDCGDMFENGSFLRRRKRFK
VLRADHAHLHSGSSKGAPGTGPGGHLHPHHPHHAHHHHHHHHHAAHHHHHHHPPQPPPPPPHMVPYFHQQPAPAPQPPHLPSQPAQQPPPQSQPPQTSHPGKMQEAAAVA
AAAAAAAAAAVGSVGRLSQFPPYGLGSAAAAAAAAAASTTGFKHPFAIENIIGRDYKGVLQAGGLPLASVMHHLGYPVPGQLGNVVGSVWPHVGVMDSVAAAAAAAAAAG
VPVGPEYGAFGVPVKALCHSANQSLPAVPVPIKPTPALPTTLPPALAVPTASQQLPAPSTVCAAAASPTAPLLEPTAAGRADSKGGSLHSVLVHS*
56 >lcl|NP_001162121.1|Plus1complement(32892262..32893206) NW_047658 SRY (sex determining region Y)-box 12 Sox12 __SEG__ Chr3 {Rattus norvegicus} MVQQRGARAKRDGGPPPPGPGPAAEGAREPGWCKTPSGHIKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADYPDYKYR
PRKKSKGAPAKARPRPPGGGGGGSRLKPGPQLPGRGGRRATGGPLGGGAAAPEDDDEDEEEELLEVRLLETPGRELWRMVPAGRAARGPAERAQGPSSEGAAASAASPTL
SEDEEPEEEEEEAATAEEGEEETVASGEEPLGFLSRMPPGPTGLDCSALDRDPDLLPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY*
57 >lcl|NP_001163949.1|Plus110164872..10166617 NW_047531 zinc finger protein 319 Zfp319 __SEG__ Chr19 {Rattus norvegicus} MSESWQQPPQTQPQQPQAPQPQHHAEPPPALAEHTLPPGTAENPLGCAVYGILLQPDPGLQPPQHAPLQAGEPGPKCGVCGHDLAHLSSPHEHQCLAGHDRSFQCTQCLK
IFHQATDLLEHQCVQAEQKPFVCGVCKMGFSLLTSLAQHHSSHTGMVKCSICDKTYKPAEAAEPATTTAPSLPSAPPPTNVAPVEQPEKPYSCPICQKPFKHLSELSRHE
RIHTGEKPYKCTLCDKSFSQSSHLVHHKRTHSSERPYKCAVCEKTFKHRSHLVRHMYAHSGEHHLFRCNVCELHFKESSELLQHPCTPSGERPFRCGECQKAFKRPSDLR
QHERTHSAERPFKCDLCPMGFKQQYALMRHRRTHKTEEPFKCGLCEKGFGQPSHLLYHQHVHTLETLFKCPVCQKGFDQSAELLRHKCLPGSTERPFKCPVCNKAYKRAS
ALQKHQLSHCAAAEKPLRCTLCERRFFSSSEFVQHRCDPTREKPLKCPDCEKRFKYASDLQRHRRVHTGEKPYKCPNCDKAFKQREHLNKHQGVHAREQQFKCVWCGERF
LDVALLQEHSAQHSAAAAAAEGAYQVAACLP*
58 >lcl|NP_001163953.1|Plus16338195..6338644 NW_047601 atonal homolog 7 Atoh7 __SEG__ Chr20 {Rattus norvegicus} MKSACKPHGPPAGARGAPPCAGAAERAVSCAGPGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIVALTRILAEAERDWVGLRCE
QRGRNHPYLPFPGARLQVDPEPYGQKFFGFQPESFPMAS*
59 >lcl|NP_036656.1|Plus13856240..3857316 NW_047557 CCAAT/enhancer-binding protein alpha Cebpa __SEG__ Chr1 {Rattus norvegicus} MESADFYEAEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAP
AGPGGAVMSAGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGH
PTPPPTPVPSPHPAPAMGAAGLPGPGGSLKGLAGPHPDLRTGGGGGGGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQ
LSRELDTLRGIFRQLPESSLVKAMGNCA*
60 >lcl|NP_036692.1|Plus116159488..16160930 NW_047760 forkhead box protein G1 Foxg1 __SEG__ Chr6 {Rattus norvegicus} MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHHHHHHHHPPPPAPQPPPPPPQQQQQPPPAPQPPQARGAPAADDDKGPQPLLLPPSAALDGA
KADALGAKGEPGGGPAELAPVGPDEKEKGAGAGGEEKKGAGEGGKDGEGGKEGDKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSI
RHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPM
PYSSVLTQNSLGNNHSFSTANGLSVDRLVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTSYFFPHVPHPSMTSQTSTSMSARAASSSTSPQAPS
TLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNPLIH*
61 >lcl|NP_036763.1|Plus19866872..9867636 NW_047658 prion protein precursor Prnp __SEG__ Chr3 {Rattus norvegicus} MANLGYWLLALFVTTCTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQSGGTWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWSQGGGTHNQWNKPSKPKTNLK
HVAGAAAAGAVVGGLGGYMLGSAMSRPMLHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQK
ESQAYYDGRRSSAVLFSSPPVILLISFLIFLIVG*
62 >lcl|NP_036963.1|Plus1complement(3783416..3783868) NW_047557 CCAAT/enhancer-binding protein gamma Cebpg __SEG__ Chr1 {Rattus norvegicus} MSKLSQPASTAGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVPPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKL
LTKELSVLKDLFLEHAHNLADNVQPISTETTVANSDNTGQ*
63 >lcl|NP_037101.1|Plus1complement(25062999..25066706) NW_047816 insulin receptor substrate 1 Irs1 __SEG__ Chr9 {Rattus norvegicus} MASPPDTDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAPKRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQAL
LQLHNRAKAHHDGAGGGCGGSCSGSSGVGEAGEDLSYDTGPGPAFKEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEV
GRSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSSCSNPISVPLRRHHLNNPPPSQVGLTRRSRTESITATSPASMVGGKPGSFRVRASSDGEGT
MSRPASVDGSPVSPSTNRTHAHRHRGSSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSPSDGGFISSDEYGSSPCDFRSSFRSV
TPDSLGHTPPARGEEELSNYICMGGKGASTLTAPNGHYILSRGGNGHRYIPGATMGTSPALTGDEAAGAADLDNRFRKRTHSAGTSPTISHQKTPSQSSVVSIEEYTEMM
PAAYPPGGGSGGRLPGYRHSAFVPTHSYPEEGLEMHHLERRGGHHRPDSSNLHTDDGYMPMSPGVAPVPSNRKGNGDYMPMSPKSVSAPQQIINPIRRHPQRVDPNGYMM
MSPSGSCSPDIGGGSCSSSSISAAPSGSSYGKPWTNGVGGHHTHALPHAKPPVESGGGKLLPCTGDYMNMSPVGDSNTSSPSECYYGPEDPQHKPVLSYYSLPRSFKHTQ
RPGEPEEGARHQHLRLSSSSGRLRYTATAEDSSSSTSSDSLGGGYCGARPESSVTHPHHHALQPHLPRKVDTAAQTNSRLARPTRLSLGDPKASTLPRVREQQQQQQQQQ
QSSLHPPEPKSPGEYVNIEFGSGQPGYLAGPATSRSSPSVRCLPQLHPAPREETGSEEYMNMDLGPGRRATWQESGGVELGRVGPAPPGAASICRPTRSVPNSRGDYMTM
QIGCPRQSYVDTSPVAPVSYADMRTGIAAEKVSLPRTTGAAPPPSSTASASASVTPQGAAEQAAHSSLLGGPQGPGGMSAFTRVNLSPNHNQSAKVIRADTQGCRRRHSS
ETFSAPTRAGNTVSFGAGAAGGGSGGGSEDVKRHSSASFENVWLRPGDLGGASKESAPGYGAAGGLEKSLNYIDLDLVKDVKQHPQDCPSQQQSLPPPPPHQPLGSNEGS
SPRRSSEDLSTYASINFQKQPEDRQ*
64 >lcl|NP_058876.2|Plus126992328..26993548 NW_047774 pleckstrin homology-like domain family A member 1 Phlda1 __SEG__ Chr7 {Rattus norvegicus} MRRTPAAERLSELGFPPRRGSQEPPFPLGVTRGWGGWPIEKRCEGPRPVPFSERSAEDGREQPAHGSGILWRVRTRLSLCRDPEPPPPPPPLCLLRVSLLCALRAGGRGS
RWSEDSARLLLLPPAGASGSLKAERSSSTPYAGRMLESSGCKALKEGVLEKRSDGLLQLWKKKCCILTEEGLLLIPPKQVQHQQQQQQQQQPGQGTAEPSQPSGPAVTSL
EPPAKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQHLVQQQPPQTQQIQPQPQPQIQPQPQPQIQPQP
QPQPQPQPQPQQQPQPQQLHSYPHPHPHLYPHPHPHAHSHPHPHPHPHPHQLQHAHQPLHSQPQGHRLLRSTSNSA*
65 >lcl|NP_058948.1|Plus110728491..10729576 NW_048043 POU domain, class 3, transcription factor 4 Pou3f4 __SEG__ ChrX {Rattus norvegicus} MATAASNPYSILSSSSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNH
PNAWGASPAPNSSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASTQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALG
TLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRR
QKEKRMTPPGDQQPHEVYSHTVKTDASCHDL*
66 >lcl|NP_059060.1|Plus11371523..1372746 NW_047557 zinc finger protein 260 Zfp260 __SEG__ Chr1 {Rattus norvegicus} MLESLQPESELLHDEPDPGEKVYECDECRKTFSLEQHFVEHKKTHGGEKSPECTGCGEEFSKASSLTRHLRSRSRRESYKCGNCGRTFSQRGNFLSHQKQHAEERPSESK
KTPVPMTTIVRNQRNAGNKPYACKECGKAFNGKSYLKEHEKIHTGEKPFECNQCGRAFSQKQYLIKHQNVHSGKKPFKCNECGKAFSQKENLIIHQRIHTGEKPYECKGC
GKAFIQKSSLIRHQRSHTGEKPYTCKECGKAFSGKSNLTEHEKIHIGEKPYKCNECGTIFRQKQYLIKHHNIHTGEKPYECNKCGKAFSRITSLIVHVRIHTGDKPYECK
VCGKAFCQSSSLTVHMRSHTGEKPYGCNECGKAFSQFSTLALHMRIHTGEKPYQCSECGKAFSQKSHHIRHQRIHIH*
67 >lcl|NP_062080.1|Plus18844262..8844996 NW_047487 neurogenin 1 Neurog1 __SEG__ Chr17 {Rattus norvegicus} MPAPLETCLSDLDCASSNSGSDLSSFLTDEEDCARLQPLASTSGLSVPARRSAPTLSGASNVPGGQDEEQERRRRRGRARVRSEALLHSLRRSRRVKANDRERNRMHNLN
AALDALRSVLPSFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPASDTESWGSGAAASPCATVASPLSDPSSPSASEDFTYGPG
GPLFSFPGLPKDLLHTTPCFIPYH*
68 >lcl|NP_062091.1|Plus1complement(3626474..3627547) NW_047657 neurogenic differentiation factor 1 Neurod1 __SEG__ Chr3 {Rattus norvegicus} MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDELEAMNAEEDSLRNGGEEEDEDEDLEEEEEEEEEEDDQKPKRRGPKKKKMTKARLERFKLRRMKANARE
RNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNPDMPPHLPTASASFPVHPYS
YQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSTEFEKNYAFTMHYPAATLAGPQSHGSIFSSGAAAPRCEIP
IDNIMSFDSHSHHERVMSAQLNAIFHD*
69 >lcl|NP_062189.1|Plus1complement(4739218..4740189) NW_047659 transcription factor MafB Mafb __SEG__ Chr3 {Rattus norvegicus} MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEA
LIGSHPVPQPLQSFDGFRSAHHHHHHHHPHPHHGYPGAGVTHDELGPHAHPHHHHHHQASPPPSSAASPAQQLPTSHPGPGPHAAAAATAAGSNGSVEDRFSDDQLVSMS
VRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL*
70 >lcl|NP_062191.1|Plus1complement(8296076..8297185) NW_047536 transcription factor Maf Maf __SEG__ Chr19 {Rattus norvegicus} MASELAMNNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPMSTPCSSVPPSPSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSP
EDAVEALISNSHQLQGGFDGYARGAQQLAAAAGAGAGASLGGSGEEMGPAAAVVSAVIAAAAAQSGGAPHYHHHHHHATGHHHHPTAGAPGAAGSASASASGAGGAGGGG
PASAGGGGGGGGGGTAGAGGALHPHHAAGGLHFDDRFSDEQLVTMSVRELNRQLRGVSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHVLESEKNQLLQQVDHLKQEI
SRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFM*
71 >lcl|NP_062199.1|Plus1complement(2474932..2476080) NW_047338 neurogenic differentiation 2 Neurod2 __SEG__ Chr10 {Rattus norvegicus} MLTRLFSEPGLLSDVPKFASWGDGDDDEPRSDKGDAPPQPPPAPGSGAPGPARATKPVSLRGEEVPEPTLAEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRK
MTKARLERSKLRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQG
ADGAGRFHGSGGPFAMHPYPYPCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLSPPLCLNGNFSLKQDSSPDHEKSYHYSMHYS
ALPGSRPAGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPMYEELNAFFHN*
72 >lcl|NP_067723.1|Plus17126294..7126776 NW_047817 twist-related protein 2 Twist2 __SEG__ Chr9 {Rattus norvegicus} MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLA
ARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH*
73 >lcl|NP_067727.2|Plus1complement(2586585..2588663) NW_047514 synaptopodin Synpo __SEG__ Chr18 {Rattus norvegicus} MEGYSEEASLLRHLEKVASEEEEVPLVVYLKENAALLTANGLHLSQNRETQQSSPNPPETEEVPSPAADINQNPSSPNATLTTAASNSHHNQPTADVNQNPPATITPVQQ
NSSETQCSPNGTLDSKPNTPSADDGQRPVPAEEVRSSILLIDKVSAPPSAASPFSREATPLSSSGPPAADLMSSSLLIGMQPSTLVASAEQEVSGHAAVTTPTKVYSEVH
LTLAKPASVVNRTARPFGMQSPGTTSQIEQSPMMGRRHFGEKAWAPPASSMADRSPQPQRHIMARSPMVERRLVGQRSPVVERRPLGNFTPPPTYAETLSTAPVASQVRS
PPSYSTLYPSSDPKPPHLKGQVVPANKTGILEESMARRGSRKSMFTFVEKPKVTPNPDLLDLVQTADEKRRQRDQGEVGMEDEPFALGAEASNFQQEPIARDRSGPAAAE
ETVPEWASCLKSPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEKYVIESSGHAELARCPSPTMSLPSSWKYTTNAPGGFRVASLSPARTPPASLYHGYLPENGVLRP
EPTKQQPHQMRPSLYALSPVKEPAKISSRATSSRASSRTVSPRAASPAKPSSLDLVPNLPRAGLPPSPALPRPSRSSPGLYNAPVQDSLQPTAVSPTYSSDISPVSPSRA
WSPRAKQAPRPSFSTRNAGIEAQVWKPSFCFK*
74 >lcl|NP_067732.1|Plus110413128..10413772 NW_047601 neurogenin 3 Neurog3 __SEG__ Chr20 {Rattus norvegicus} MAPHPLDAPTIQVSQETQQPFPGASDHEVLSSNSTPPSPTLVPRDCSEAEAGDCRGTSRKLRARRGGRNRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVL
PTFPDDAKLTKIETLRFAHNYIWALTQTLRIADHSFYGPEPPVPCGELGSPGGGSSGDWGSIYSPVSQAGSLSPTASLEEFPGLQVPSSPSCLLPGTLVFSDFL*
75 >lcl|NP_068538.2|Plus131244372..31245157 NW_047354 oligodendrocyte transcription factor 1 Olig1 __SEG__ Chr11 {Rattus norvegicus} MYYAVSQARVNAAPATMLRPQRPGDVQLGASLYELVGYRQPPISSSSSTSSSSTASLLPKPAREKPEAPLAEPRGPAPESGGARADAKEEQQQQQLRRKINSRERKRMQD
LNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGDGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPETLRPTKYLSLALDEPPCG
QFALPAGGAGSPGLCSCAVCKFPHLVPAGLGLAAVQAQFSK*
76 >lcl|NP_068607.1|Plus1complement(2095584..2096588) NW_047717 transcription factor AP-1 Jun __SEG__ Chr5 {Rattus norvegicus} MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGF
AEGFVRALAELHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGALSSGGGAPSYGATGLAFPSQPQQQQQPPQPPHHLPQQIPV
QHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQ
LQTF*
77 >lcl|NP_068609.1|Plus1complement(222985..224277) NW_048036 myc-like oncogene, s-myc protein Mycs __SEG__ ChrX {Rattus norvegicus} MLSCTTSTMPGMICKNSDLEFDSLKPCFYPEDDDIYFGGRNSTPPGEDIWKKFELLPTPRLSPGRALAEDSLEPANWATEMLLPEADLWSNPAEEEDIFGLKGLSGSSSN
PVVLQDCMWSGFSSREKPETVVSEKLPGGCGSLAVGAGTLVPGAAAAASSAGHARSGTAGVGRRKAAWLTELSHLDSECVDSAVIFPANKRESMPVATIPASAGAAISLG
DHQGLSSSLEDFLSNSGYVEEGGEEIYVVMLGETQFSKTVTKLPTAAHSENAALTPECAQSGELILKRSDLIQEQHNYAAPPLPYAEDARPLKKPRSQDPLGPLKCVLRP
KAPRLRSRSNSDLEDIERRRNHNRMERQRRDIMRSSFLNLRDLVPELVHNEKAAKVVILKKATEYIHTLQTDESKLLVEREKLYERKQQLLEKIKQSAVC*
78 >lcl|NP_071779.1|Plus1complement(597453..598154) NW_047774 achaete-scute homolog 1 Ascl1 __SEG__ Chr7 {Rattus norvegicus} MESSGKMESGAGQQPQPPQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQAPQQQAPQLSPVADGQPSGGGHKSAAKQVKRQRSSSPELMRCKRRLNFSGFGYSLP
QQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLS
PEEQELLDFTNWF*
79 >lcl|NP_073169.1|Plus110635592..10637160 NW_047399 zinc finger protein 238 Zfp238 __SEG__ Chr13 {Rattus norvegicus} MEFPDHSRHLLQCLSEQRHQGFLCDCTVLVGDAQFRAHRAVLASCSMYFHLFYKDQLDKRDIVHLNSDIVTAPAFALLLEFMYEGKLQFKDLPIEDVLAAASYLHMYDIV
KVCKKKLKEKATTEADSTKKEEDASSCSDKVESLSDGSSHMAGDLPSDEDEGEDDKLNILPSKRDLAAEPGNMWMRLPSDAAGIPQAGGEAEPHATAAGKTVASPCSSTE
SLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQVKVEKEASCDESDVGTNDYDMEHSTVKESVSANNRVQYEPAHLAPLREDSVLRELDRED
KASDDEMMTPESERVQVEGGMESSLLPYVSNILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGIRSKPAADVNVPTCSLCGKTFSCMYTLKRHERTHSGEKPYTC
TQCGKSFQYSHNLSRHAVVHTREKPHACKWCERRFTQSGDLYRHIRKFHCELVNSLSVKSEALSLPTVRDWTLEDSSQELWK*
80 >lcl|NP_074049.1|Plus1complement(13649252..13650580) NW_047491 forkhead box Q1 Foxq1 __SEG__ Chr17 {Rattus norvegicus} MGSDLEGAGSSDVPSPLSAAGDDSLGSDGDCAANSPAAGRGAVDLEGGGGERNSSGGASTQDDPEVTDGSRTQASPVGPCAGSVGGGEGARSKPYTRRPKPPYSYIALIA
MAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRTTVSASGLRPEEAPPGPAGT
PQPAPTAGSSPIARSPARQEEGSSPASKFSSSFAIDSILSKPFRSRRDGDPALGVQLPWSAAPCPPLRAYPALLPASSGGALLPLCAYGAGEPTLLASRGAEVQPAAPLL
LAPLSTAAPAKPFRGPETAGAAHLYCPLRLPTALQAAAACGPGPHLSYRVETLLA*QELGALLVGLGWSWEHLLSWRAPFVMEVGMRAPGLCTFHLPRGIEIFFSTLHQM
CLK
81 >lcl|NP_077039.3|Plus15433347..5434240 NW_047660 CCAAT/enhancer-binding protein beta Cebpb __SEG__ Chr3 {Rattus norvegicus} MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERAIDFSPYLEPLAPAAADFAAPAPAHHDFLSDLFADDYGAKPSKKPSDYGYV
SLGRAGAKAAPPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLSTSSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKAVD
KLSDEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC*
82 >lcl|NP_112259.1|Plus1188603..190456 NW_047370 VGF nerve growth factor inducible precursor Vgf __SEG__ Chr12 {Rattus norvegicus} MKTFTLPASVLFCFLLLIRGLGAAPPGRSDVYPPPLGSEHNGQVAEDAVSRPKDDSVPEVRAARNSEPQDQGELFQGVDPRALAAVLLQALDRPASPPAVPAGSQQGTPE
EAAEALLTESVRSQTHSLPASEIQASAVAPPRPQTQDNDPEADDRSEELEALASLLQELRDFSPSNAKRQQETAAAETETRTHTLTRVNLESPGPERVWRASWGEFQARV
PERAPLPPSVPSQFQARMSENVPLPETHQFGEGVSSPKTHLGETLTPLSKAYQSLSAPFPKVRRLEGSFLGGSEAGERLLQQGLAQVEAGRRQAEATRQAAAQEERLADL
ASDLLLQYLLQGGARQRDLGGRGLQETQQERENEREEEAEQERRGGGEDEVGEEDEEAAEAEAEAEEAERARQNALLFAEEEDGEAGAEDKRSQEEAPGHRRKDAEGTEE
GGEEDDDDEEMDPQTIDSLIELSTKLHLPADDVVSIIEEVEEKRKRKKNAPPEPVPPPRAAPAPTHVRSPQPPPPAPARDELPDWNEVLPPWDREEDEVFPPGPYHPFPE
YIRPRTLQPPASSRRRHFHHALPPARHHPDLEAQARRAQEEADAEERRLQEQEELENYFEHVLLHRP*
83 >lcl|NP_445951.1|Plus14330047..4331171 NW_047688 mitochondrial transcription termination factor precursor Mterf __SEG__ Chr4 {Rattus norvegicus} MASRNIWRVRRNFLFDLRGWVPQYSAEVFLKSISFRPFSVECNSKDGENGDLLNNLLTMGVDVDMARRRQPGVFNRAVTNEQELKMFLLSKGASDKVIGSIISRYPRAIT
RTPESLSKRWDLWREIMASDLEIVNILERSPESFFRSNNNLNLENNIKFLCSVGLTHKCLCRLLTSAPRTFSNSLNLNKQMVEFLQETGISLGHNNPTDFVRKIISKNPS
ILIQSTKRVKTNIEFLQSTFNLDKEDLLLLICGPGARILDLSNDCTKRNYTNIKKRLLSLGCTEEEVQKFVLSYLNMIFLSEKKFNDKIDCLLEEKISTSQILENPRVLD
SSIHTLKTRIRELAHAGYDVSTSSIALLSWSQRRYEAKLKRLSG*
84 >lcl|NP_445982.1|Plus14727366..4727977 NW_047759 twist gene homolog 1 Twist1 __SEG__ Chr6 {Rattus norvegicus} MMQDVSSSPVSPADDSLSNSEEEPDRQQPASGKRGARKRRSSRRSAGGSAGPGGATGGGIGGGDEPGSPAQGKRGKKSAGGGGGAGGGGGGGGSSSGGGSPQSYEELQTQ
RVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH*
85 >lcl|NP_598233.2|Plus119462676..19463590 NW_047491 hepatoma derived growth factor-like 1 Hdgfl1 __SEG__ Chr17 {Rattus norvegicus} MSCFSRPKYKTGDLVFAKLKGYAHWPARIEHVTEPNRYQVFFFGTHETALLGPKHLFPYEESKERFGKPNKRRGFSEGLWEIEHDPMVEASPCLCPDEEQLCAEEPGPGE
EPEPGQELEPESRPELESMPELEAEPRPEKECEQEPEQEPEQEPEQELEQEPELEPEPEPEPEPEPEPEPEPEPQPAYDLLDAKEEPGLIEAEPGDQQAEQVREQHAEAE
VMAVVEEPESLKRSAEDEQPHSPPKRPREAAPGALEMEPAGEREAEACPFVEEPDQAQEQQTPLEEEATEEAVQGLMVGEIEGL*
86 >lcl|NP_604461.2|Plus1306874..307188 NW_047710 double-stranded RNA-binding protein Staufen homolog 2 isoform LS (B) Stau2 __SEG__ Chr5 {Rattus norvegicus} PKGILHLSPDVYQEMEASRHRVTSGTTLGYLSPKDMNQPSSSFFSVESPSPTSSAPAARELLMNGTSPAAEAIGLKGSSPTPPCSSVQPSKQLEYLARIQGFQV*
87 >lcl|NP_620192.1|Plus17986391..7987353 NW_047814 POU class 3 homeobox 3 Pou3f3 __SEG__ Chr9 {Rattus norvegicus} PHQGHPGGWGAAAAAAAAAAAAAAAAHLPSMAGGQQPPPQSLLYSQPGGFTVNGMLSAPPGPGGGGGGAGGGAQSLVHPGLVRGDTPELAEHHHHHHHHAHPHPPHPHHA
QGPPHHGGGGAGPGLNSHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKI
AAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTSVQ*
88 >lcl|NP_620193.1|Plus15139281..5140636 NW_047719 POU class 3 homeobox 1 Pou3f1 __SEG__ Chr5 {Rattus norvegicus} MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGSTGRADDGGGGG
GFHARLVHQGAAHAGAAWAQGGTAHHLGPAMSPSPGAGGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGGAGPGLHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHA
GGLHAAAAHLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNL
DKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPGGGGASPPSAPPPPPPAALHH
HHHHTLPGSVQ*
89 >lcl|NP_620230.1|Plus1complement(1578873..1579898) NW_047470 jun D proto-oncogene Jund __SEG__ Chr16 {Rattus norvegicus} METPFYGEEALSGLAAGASSVAGAAGAPGGGGFAPPGRAFPGAPPTSSMLKKDALTLSLAEQGAAGLKPGSATAPSALRPDGAPDGLLASPDLGLLKLASPELERLIIQS
NGLVTTTPTSTQFLYPKVAASEEQEFAEGFVKALEDLHKQSQLGAATAATSGAPAPPAPADLAATPGATETPVYANLSSFAGGAGPPGGAATVAFAAEPVPFPPPPGALG
PPPPPHPPRLAALKDEPQTVPDVPSFGDSPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGC
QLLPQHQVPAY*
90 >lcl|NP_620264.1|Plus12995031..2996143 NW_047712 forkhead box E1 (thyroid transcription factor 2) Foxe1 __SEG__ Chr5 {Rattus norvegicus} MTAESAPPPPPQPEALAAVKEERGEAAAGAGVPAEVAGRGAGGRRRKRPLQRGKPPYSYIALIAMAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLND
CFLKIPREAGRPGKGNYWALDPNAEDMFESGSFLRRRKRFKRSDLSTYPAYMHDAAAAAAAAAAAIFPGAVPAARPAYPGAVYAGYAPPLAAPPPVYYPAASPGPCRVFG
LVPERPLSPDLGPAPSAAGGSCAFAAAAGAPGTGSFQPAVCTGARPVNPAAYAAAYAGPDGAYPQGASSALFAAAAGRLAGPTSPTAGGGSGGVEATVDFYGRTSPGQFG
AALGPCYNPSGQLGAGGGGAYHSRHATAYPGAVDRFVSAM*
91 >lcl|NP_742082.1|Plus1complement(11594836..11596173) NW_047711 POU class 3 homeobox 2 Pou3f2 __SEG__ Chr5 {Rattus norvegicus} MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSHGGSGGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQ
QGGRGDELHGPGALQQQHQQQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPSMGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDA
HDEPHHADHHPHPHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLL
NKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGV
QTPVQ*
92 >lcl|NP_758828.1|Plus13114099..3115448 NW_047819 zinc finger protein 161 Zfp161 __SEG__ Chr9 {Rattus norvegicus} QEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTYFKKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMS
SGQILGIRFLDKLCSQKRDVSSPDESNGQSKSKYCLKLNRPIGDAADAQDDDVEEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEV
ESMETPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGY
KPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTPSAIQSETEQLQAAAMAAEAE
QQLETIACS*
93 >lcl|NP_908937.2|Plus15865064..5865858 NW_047617 TAF9 RNA polymerase II, TATA box binding protein-associated factor isoform b Taf9 __SEG__ Chr2 {Rattus norvegicus} MESGKMASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPTVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPY
SGPRLPPDRYCLTAPNYRLKSLQKKAPTPAGRITVPRLSVGSVSSRPSTPTLGTPTPQAMSVSTKVGTPMSLTGQRFTVQMPASQSPAVKASIPATPAVQNVLINPSLIG
SKNILITTNMVSQNTANESANALKRKREEEDDDDDDDDDDYDNL*
94 >lcl|XP_001053854.2|Plus1164768..165106 NW_047479 transcription elongation factor B (SIII), polypeptide 1 LOC679646 __SEG__ Chr16 {Rattus norvegicus} MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAVNFL
DC*
95 >lcl|XP_001053910.1|Plus1complement(183238..183576) NW_047479 transcription elongation factor B (SIII), polypeptide 1 LOC679663 __SEG__ Chr16 {Rattus norvegicus} MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQLAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPTAPEIALELLMAVNFL
DC*
96 >lcl|XP_001055972.2|Plus1complement(5293116..5294414) NW_047564 forkhead box protein D4 Foxd4 __SEG__ Chr1 {Rattus norvegicus} MNLARAGHLLSTPPPSPLSSDPEEVEIDVLAEEEDGDQTEDDGGEESHKCLERSLQRPGARTLARRSAWDCGDLSNSSGFLRKFRAPRTRATTTTADGPQPAKPPYSYIA
LITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLRRRKRFKRHHPPPGGHPHCPFPPPAVP
ATVQVSQPGLLLRYSAPPQPNLAVHPASPPRSRPCAPLHPYPLRYLLLAAPAYADEPRKAEGADPATSLAIPALQPAPGSQPWEGDQGSGSRSRRGCASFTIESIMQGVT
GGGTGSAQSPPFAPWSYCHLLQHPPCLLHPTGRFPFVSRARSFPDSVAAAAAAAAAVAAGRASLCH*MLSR*RQAARPRHLSASED*RLTTSFRAERGPCPHF
97 >lcl|XP_001057782.1|Plus13351577..3352944 NW_047617 forkhead box protein D1 Foxd1 __SEG__ Chr2 {Rattus norvegicus} MTLSTEMSDASGLAEETDIDVVGEGEDEEEEEDDDDEGGGGSQLPSSAQRRRRSYAGEDELEDLEEEDDDEDLLLASRPAASPAPPGPAPAPGAGSGGCSGAGAGGGAGG
GVGAGAGTGGGGSSKNPLVKPPYSYIALITMGILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFL
RRRKRFKRQPLLAPHAAAEALLLRGAGPAASAGDPGAALFPPPPPPTACGYGAYGCAYGLQLPPCAPPSALFAAAAAAAAAAFHPHSPPPPPPPPPPPGAAAELARTAFG
YRPHALAAALPGPLQAAAVKAGGPGTAALARSPFSIESLIGRTRGPATAGAHASPGATSGTAPGPGGGGCAVQAAAGPAVALTRSLVVAAAAAASSVSSSAALGTLHQGT
ALSSVENFTARISNC*
98 >lcl|XP_001058777.1|Plus1complement(5535384..5535722) NW_047369 transcription elongation factor B (SIII), polypeptide 1 LOC680767 __SEG__ Chr12 {Rattus norvegicus} MDGEEKTYGGYEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHALSKVCMYFTYRVRYTNSSTEIPEFPIAPEIALELLMAENFL
DC*
99 >lcl|XP_001061465.1|Plus18151527..8152240 NW_047492 TGFB-induced factor homeobox 2-like Tgif2 __SEG__ Chr17 {Rattus norvegicus} MSNSDLGEDEGLLSLTGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSS
PSLLAVSVPAPTNMLSLSVCSMPLHSGQGEKPAASFPQVELESPKALVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKDDFSSFQLLVEVALQRAAEMELQKQQDP
APPLLHTPLPLVSENAK*
100 >lcl|XP_001063064.2|Plus1complement(28696143..28696541) NW_047354 hypothetical protein LOC685261 __SEG__ Chr11 {Rattus norvegicus} MSYYSSYYGGLGNGYGGFGGLGYGCSSIHRLSYGSGFGGHGYGSGFGGYRYVSGFGGHRYGSGFGGHGYGFGFGGHRYGSGFGVHRYGSGFGGHRYGSAFGGHGYRSGFG
GHGYRSGFGGHGYGFGFGGHGY*
101 >lcl|XP_001063101.1|Plus1985235..985438 NW_047683 Ab1-108-like LOC681193 __SEG__ Chr4 {Rattus norvegicus} MIIPVCCFTCGKIIGNKWEAYLGLLQAMYTEGDALDTLDLKRYCCRCMLLAHADLIEKLLNYALLEK*
102 >lcl|XP_001063234.1|Plus1complement(28716033..28716233) NW_047354 hypothetical protein LOC685304 __SEG__ Chr11 {Rattus norvegicus} MSYYGSYYGGYYGGLGSGYRGFGNLGYGYGCGCGFGGHGYGSVYGRYGYGYRRPFYYGGYGFSRFY*
103 >lcl|XP_001063382.1|Plus1complement(28788399..28788644) NW_047354 hypothetical protein Krtap19-3 __SEG__ Chr11 {Rattus norvegicus} MSYYGGYYGGLGYGYGGFGGLGCGYGCGCSSVRRLGYGCGYGGFGYGSGFGGYGYGSGCGGYGYGCCRPSCYGGYGFSSFY*
104 >lcl|XP_001063737.2|Plus128934324..28934503 NW_047354 hypothetical protein LOC685420 __SEG__ Chr11 {Rattus norvegicus} MCYYGSYYGGLGYGLGYGYGGLRCGYGCGYGGYGCGYGGYGYGCCRPLCCRRYWSCGFY*
105 >lcl|XP_001064282.1|Plus1complement(1461346..1461852) NW_048049 high-mobility group box 4-like LOC685552 __SEG__ ChrX {Rattus norvegicus} MGKDSKVRPKVNVSPYVHFMMDFRNQMREQQPNIYYDFTEFSRKCSEKWKTISKKEKKKYEALAKRDKDRYQREMRNYSGPRRERRRRDPDAPRKPPSSFLLFSQDHFEE
IKEQHPNWTVAQVAKAAGRMWARCSEADKIPYEERAAVLRAKYLEEREAYYQQCQRGK*
106 >lcl|XP_001065797.2|Plus1complement(1836083..1837390) NW_047773 zinc finger CCCH type containing 10 Zc3h10 __SEG__ Chr7 {Rattus norvegicus} MPDRDSYANGTGSSGAGPGGGSSEEASGAGTGSGGATSDAICRDFLRNVCKRGKRCRYRHPDMSEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGE
LPPRLRQKVAAGLGLSPADLPNGKEEVPICRDFLKGDCQRGTKCKFRHLQRDFEFEARGGGGTGGGGSTGSAPPGRRHDLYDIYDLPERGFEDHEPGPKRRRGGCCPPDG
PHFESYECNLAPLRGVECRLLEEENALLRKRVEELKKQVSNLLATNEVLLEQNAQFRNQAKVMTLSSTAPATEQTLAPTVGTVATFNHGIAQTHTTLSSQALQPRPVSQQ
ELVAPAGAPAAPPTNAAPPAAPPPPPPHLNPEITPLSAALAQTIAQGMAPPPVSMAPVAVSVAPVAPVAVSMAQPLAGITMSHTTTPMVTYPIASQSMRITAMPH*
107 >lcl|XP_001067879.1|Plus1complement(18338121..18338843) NW_047492 small nuclear ribonucleoprotein N LOC688682 __SEG__ Chr17 {Rattus norvegicus} MTVGKSSKMLQHIDYRMRCILQDGRFFIGTFKAFDKHRNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLASAAGGPGVGRAA
GRGVPAGVPIPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAVAATASIAGAPTQYPPGRGTPPPPVGRATPPPGIMAPPPGMRPPMGPPIGLPPAQGRPIGMPPPGM
RLPPPGIRGPPPPGMRPPRP*
108 >lcl|XP_001068941.1|Plus1complement(42260411..42261055) NW_047625 high mobility group box 1 LOC689398 __SEG__ Chr2 {Rattus norvegicus} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEVSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYR
PKIKGEHPGLSIGDVAKKLGEMWNNTASDDKQPYEKKAAKLKEKYEKDTAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDE*
109 >lcl|XP_001071853.2|Plus1complement(3124347..3124685) NW_047470 transcription elongation factor B (SIII), polypeptide 1 LOC689743 __SEG__ Chr16 {Rattus norvegicus} MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVCYTNSSTEIPEFPIAPKIALELLMAVNFL
DC*
110 >lcl|XP_001074673.1|Plus134939912..34940553 NW_047658 high mobility group box 1 LOC690521 __SEG__ Chr3 {Rattus norvegicus} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKAMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFLFCSEYRP
KIKGEHPALSIGDVTKKLGEVWTNTASDDKQPCEKMAAKLKEKYEKDTAAYRAKGKPDAAKKGVVKAERSKKKKEEEDDEEDEDDEEEEEEEDEDDEEDDDDE*
111 >lcl|XP_001076232.1|Plus1complement(68369..69013) NW_047674 high mobility group box 1 LOC690940 __SEG__ Chr3 {Rattus norvegicus} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEVSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYR
PKIKGEHPGLSIGDVAKKLGEMWNNTASDDKQPYEKKAAKLKEKYEKDTAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDE*
112 >lcl|XP_001076590.1|Plus1631982..632488 NW_048032 high-mobility group box 4-like LOC691030 __SEG__ ChrX {Rattus norvegicus} MGKDSKVRPKVNVSPYVHFMMDFRNQMREQQPNIYYDFTEFSRKCSEKWKTISKKEKKKYEALAKRDKDRYQREMRNYSGPRRERRRRDADAPRKPPSSFLLFSQDHFDE
IKEQHPNWTVGQVAKAAGRMWARCSEADKIPYEERAAVLRAKYLEEREAYHQQCQRGK*
113 >lcl|XP_001076648.2|Plus1<1113849..1114367 NW_048032 high-mobility group box 4-like LOC691047 __SEG__ ChrX {Rattus norvegicus} HGKEVHSRPKVNVSSYIHFMLNFRDQVKEQQPNTYHHFASFSRKLSEKWRSISKPENVENEALDKLNKGQYKDKMRNYRRKRRKRRRDANTLHKPPSSFLMFSLDHFTQL
KKENTKWTVVEVAKPARMIWSMSTNVNKISFEQKAVLLQPKYLEKWEAYCHQCQGKKSNFFG*
114 >lcl|XP_001079020.2|Plus1complement(41455906..41458005) NW_047657 zinc finger protein 770 Znf770 __SEG__ Chr3 {Rattus norvegicus} MAENSFKMLKIQQCVANKLPRNRPYICNICFKHFETPSKLARHYLIHTGQKPFECDACHKNFRQLVHLERHQLTHNLPFSCNICQRHFKNLKTFVRHQQLHNESCHSDIK
VRRLLETKQEKPVYGAYSAFTADERRALHPCSKSDPTYSTTERRKNIHACTICGKMFPSQSKLDRHALIHTGQRPFKCVLCSKSFRQSTHLKIHQLTHSEERPFQCCFCQ
KGFKIQSKLLKHKQIHTRNKTFQNLPLKVKSPESCPLPNKLNAKQDAFESGDMGESEEKNPLDVHSIYIVPFQCSECEECFESEQILNGHKCLPARGGRIPGRLKRSCNY
KTIVKKLLAKLKRAGGKKSDNLQSEKRTFKSNCLKNCECTSGKANMEQTQRTFVGSLSRHGSYKTVSKKKKTLTLPFSWQKQFQSQNMGKSLQGILKTGSILTMDGSVSN
KDLSIYGSSGEEYFNNCDMLQCGFSDSSENIHTGQKMCPCDKCDKVFPSISKLQRHYLIHTGQRPFGCNVCGKSFRQSAHLKRHKLTHIEKIPYSSFWQVDFGNVNKLFI
HPSDDVSYSASQQCEGLGSQRYESSESNQVSETEVKEESEEFILGDHCRNRQSYLASTLLESEQSRHCYTYLGRPERSDGLLYQCSVCCKHFRSPSKLERHYLIHAGQKP
FECSVCGKTFRQAPHWKRHQLTHFKERPQEKVVLDSTVT*
115 >lcl|XP_002727857.1|Plus13548943..3549461 NW_047339 Sin3A-associated protein, 18kDa RGD1561590 __SEG__ Chr10 {Rattus norvegicus} MLAAGVGGQGERLPGRRRKMAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAI
VFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPSSGRMRPY*
116 >lcl|XP_002727900.1|Plus128897194..28897373 NW_047354 hypothetical protein LOC100363489 __SEG__ Chr11 {Rattus norvegicus} MCYYGSYYGGLGYGYGGLGCGYGCGCGYGYGGYGCGYGNYGYGCCRPLCCRRYWSCGFY*
117 >lcl|XP_002727902.1|Plus128972365..28972544 NW_047354 hypothetical protein LOC100359513 __SEG__ Chr11 {Rattus norvegicus} MCYYGSYYGGLGYGYGGLGCGYGCGYGCGYGGYGCGYGGYGYGCCRPLCCRRYWSCGFY*
118 >lcl|XP_002727917.1|Plus1complement(28817763..28818140) NW_047354 hypothetical protein LOC100363490 __SEG__ Chr11 {Rattus norvegicus} MSLEDSVVCLTCHSGSIKGPSLVSSTYTLQKLLICLKETPIPDSMCYGNYFGGLGYGYGDLGYGYGGLGYGYGGLGYGYGGLGYGYGGLGYGYGGLGYGYGCGCGSRYAY
STYRPCCYGRVSGLY*
119 >lcl|XP_002727918.1|Plus128926527..28926721 NW_047354 hypothetical protein LOC100359560 __SEG__ Chr11 {Rattus norvegicus} MCYYGSYYGGLGYGYGGLGCGYGCGCGCGYGCGYGCGYGCGYGGYGYGCCRPLCCRRYWSCGIY*
120 >lcl|XP_002728063.1|Plus1159632..161365 NW_047398 rCG46571-like LOC100362915 __SEG__ Chr13 {Rattus norvegicus} MSSGSEEDYVYSLLFVPPLLTPSAGAGSQAKLFLGEAGIRSGAMAQVDSQERWTKVALGGMIRDSQTLSVNLESEEEDGREGGSPVTQNNTDLQFDTQSCKEEDNWSECF
RAGCVEQRPGKIPRKTNNWGGRGWRITQTQDSPGLQEALGAPSRSFLYKVQMQPLRDSVGSDRVKKENKDPASEALTSFLDTGGSFGTQNSLEASSLDKNSLEHFPRFES
TPAQTSSIPAGLAAGLVKAQGSRKAQGQVGPEGSRQEEEGPDRCVQGRRAFQKSSELQVSAEQRGIKPYVCQLCGKAYSHRSTLQQHRRLHTGERPYRCPFCDKAYTWSS
DHRKHIRTHTGEKPYGCPDCGRAFVRSSDLRKHQRNMHSNDKPFPCAQCGLTFNRPLSLLRHQRTHLGAKPFRCSCCSREFSVASRMVEHQRVHSGERPFPCSICGKCFT
KSSNLHEHQTLHTGQRPFKCADCGVTFAQPSRLLRHQRIHTGERPFPCAECGQAFARSSTLKRHQQTHSGDKDFLCAECGRAFRIASELAQHIRMHNGERPYQCEGCGQT
FTRSSHLQRHQAKHDTCKEPVPSSSDE*
121 >lcl|XP_002728075.1|Plus1complement(4708142..4708480) NW_047399 hypothetical protein LOC100359583 __SEG__ Chr13 {Rattus norvegicus} MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVETKKQKKTDE
DD*
122 >lcl|XP_002728171.1|Plus1complement(10910523..10911584) NW_047430 protein arginine methyltransferase 1-like LOC100361025 __SEG__ Chr14 {Rattus norvegicus} MAAAEAANCIMEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVK
IVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHAHDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVD
VVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLD
FTIDLDFKGQLCELSCSTDYRMR*
123 >lcl|XP_002728435.1|Plus13950110..3950448 NW_047470 transcription elongation factor B (SIII), polypeptide 1 LOC100361241 __SEG__ Chr16 {Rattus norvegicus} MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPTAPEIALELLMAVNFL
DC*
124 >lcl|XP_002728458.1|Plus1complement(2428793..2429848) NW_047474 purine-rich element binding protein G isoform 1 Purg __SEG__ Chr16 {Rattus norvegicus} MERARRRGGGGGGGGGRGRGAKNVGGSGLSKSRLYPQAQHSHYPHYSASATPNQSGGASEIQELASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLT
LSLSVAAELKDCLGDFIEHYAHLGLKGHRQEHGQSKEQVSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHSL
GQEQTIVLPAQGMIEFRDALVQLIEDYGEGDIEERRGGDDDPLELPEGTSFRVDNKRFYFDVGSNKYGIFLKVSEVRPPYRNTITVPFKAWTRFGENFIKYEEEMRKICN
SHKEKRMDGRRASGEEQGCLD*
125 >lcl|XP_002728486.1|Plus1complement(<5092..5433) NW_047478 hypothetical protein LOC100360411 __SEG__ Chr16 {Rattus norvegicus} MEPGSQAGALQEILDCLCRESDPGKIYKTLKKLSSVPILCDSLAEIGFRKTIKTLKNQQLLLPFVKDLVDKWSPGFVLGPQQEQDSLDFGLLRSHRTAHQSTGLEQTNQE
QIFQ
126 >lcl|XP_002728515.1|Plus1complement(13344113..13345774) NW_047491 forkhead box C1 Foxc1 __SEG__ Chr17 {Rattus norvegicus} MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMD
RFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKGRLHLQEPPPPQAGRQPAPAPPEQAEGSAPGPQQ
PPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAATVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDAAEPAPPPQPAPPPHHSQGFSVDNIMTSLRGSPQGSAAELGS
GLLASAAASSRAGIAPPLALGAYSPGHSSLYSSPCSQSSSAGSSGGGGGGGGGGGGSSSAAGTGGAATYHCNLQAMSLYAAGERGGHLQGPAGGGGSAAVDDPLPDYSLP
PATSSSSSSLSHGGDRPGDQPPPCVPPRPTHLVVPEPGQVETWVTWRAQRRLLRPRAILASSRTSTRCGKCSSLSGSA*TTLR*MGIVAVRWLFLPASLCTARRGLSSMT
VANS
127 >lcl|XP_002728623.1|Plus1complement(8702113..8702316) NW_047531 Ab1-108-like LOC100360929 __SEG__ Chr19 {Rattus norvegicus} MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGHALDALGLKCYCCRRVLLAHVDLIEKLLNYAPLEK*
128 >lcl|XP_002728710.1|Plus1complement(12970676..12973795) NW_047555 zinc finger protein 628 LOC100359484 __SEG__ Chr1 {Rattus norvegicus} MAGSHMDMVPASTMEGTGEKPDSTTPAPTPAAQYECGECGKSFRWSSRLLHHQRTHTGERPYKCPDCPKAFKGSSALLYHQRGHTGERPYQCPDCPKAFKRSSLLQIHRS
VHTGLRAFTCGLCGLAFKWSSHYQYHLRQHTGERPYPCPDCPKAFKNSSSLRRHRHVHTGERPYSCSICGKSFTQSTNLRQHQRVHTGERPFRCPLCPKTFTHSSNLLLH
HRTHSPAPSPAPAPAPDPTPTGETSRAGTKVLVSDAYLQPRSPPEPPAPPPQPPPVVPEFFLAAAETTVELVYRCDGCEQGFSSEELLLEHQPCPGPTVATQPQDVPAEL
PQADSALQPPPATTGPSNFACLPCGKSFQTVAGLSRHQHSHGAASGQAFRCGSCDGAFPQLASLLAHQQCHVEEAAAGRPPPQAEVAEVTCPQEPVAPATPAPPPPPPAP
VSAERPYKCAECGKAFKGSSGLRYHLRDHTGERPYQCGECGKAFKRSSLLAIHQRVHTGLRAFTCGQCGLTFKWSSHYQYHLRLHSGERPYACTECGKAFRNTSCLRRHR
HVHTGERPHSCSVCGKSFAQTSNLRQHQRVHTGERPFRCPLCPKTFTHSSNLLLHQRTHSAERPFACPICGRGFVMAAYLQRHLRTHTPATTTSGTTGPAVASQPPTPLA
AAPTPLAAQDVHVLPNLQAILSLEVAGGTAQATPPGPVAPSSQTFLLVQTAQGLQLIPSSVQPPTPPPPPPPPKLILLPPASAGGMGNGAARPGPRAVGKAGQGTGVVWF
PGPGGLGVQGGGNAGTSGGGQSLIVLQNVGSGETGPQEVSGVQLQPAQEVATVQLQPAQEVTTVQLQPAQEVTTVQLQPLTGQVSNSSGGAVATEAPNLLVVQSGAAEEL
LTSSGPGEVGDSEASAGMVQDVLFETLQTDEGLQSVLVLSGADGEQTRLCVQEVETLSPGLTEPAATDPSGQKLLIFRSAPAADLLESSSVAGGTTTLQLLAPPAPGPVS
APVGVPVAPPSQMVQVVPAVTGPGVMPPQNLPSIQIVQTLPAVQLVHTF*
129 >lcl|XP_002728736.1|Plus1complement(21485573..21486025) NW_047555 transcription elongation factor B (SIII), polypeptide 2-like LOC100359431 __SEG__ Chr1 {Rattus norvegicus} MKNKTLLTCWGEKYSTEEDTAGPPGPDLWPQASIDTGPKSSDMFLIIQCSKTTIFTDSKESSTVFKQKHIVKGSLKLQEEQRLCKENQLLHDRKTLGECGITGQRAGPQA
PAIVCLAFQADDVFEALHIEPFSSLPQLPDVTRSQDSGGQ*
130 >lcl|XP_002728824.1|Plus1complement(30104203..30105216) NW_047562 zinc finger and SCAN domain containing 2-like LOC100360446 __SEG__ Chr1 {Rattus norvegicus} MEFAAPGVTRENLDGAKLLENRTSKFSGAPRSPLDREAVLHERPLLARPEQPAPEEKLLDGQYLSRSGSGPQEEAFAKTSDPAVPKAFKCRNCGLAVASLSDLIHHQSSH
GCDRPYSCPECDKSFRRGSDLVKHYRVHTGEKPYPCPECGRCFSLSSNLTKHRRSHSGLRPHKCMECGEAFGRSADLAKHQRVHTGEKPYACAECGKTFRVSSNLIQHQR
THTGEKPYRCGLCGKSFSLSSNLLQHQRCHTGEKPYFCAWCGDSFGRSSYLLEHQRSHTGEKPYNCCECGKNFTNSSNCLRHQRTHNGEPPFRCLECGRGFSEITMFTEH
QRIHLSK*
131 >lcl|XP_002728880.1|Plus1complement(23396184..23396507) NW_047563 mCG145114-like LOC100363176 __SEG__ Chr1 {Rattus norvegicus} MEVKKSFRGNGVCVLRGGTLSGVAEARTVDTQKDVQPSKQQPMINICGECHTENEIKSRDPIRCKECGYRIMYKKRTKRLMVFDARWNRGVEERLHTFASLMFLFNV*
132 >lcl|XP_002728991.1|Plus1complement(6103529..6103867) NW_047601 transcription elongation factor B (SIII), polypeptide 1 LOC100360595 __SEG__ Chr20 {Rattus norvegicus} MDGEEKTYDGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFEENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFL
DC*
133 >lcl|XP_002729015.1|Plus1183704..184546 NW_047602 double homeobox, 1-like LOC100361986 __SEG__ Chr20 {Rattus norvegicus} MPSDSRRPRTRLNLQQRRILVQAFERNPLPGFATREQLGQRTGLNEDTIHIWFQNRRARQARAPDQDVPASQVQDVATGGHSGKDEAAPDNLLLMAAAGGVGMGNSSSSH
EESQHPQVSLPEGRGQSQTATQAYEPGTLELLLDELLEEDQVEGDRPFPVDLDGNPGGKEHGVVQETILQLAATDFVSKESSSYSDPTNFSRESQLPQWAQPEGQGQEQA
LTQGCNRGPLELFLDQLLMEVRVETLSPGPVHLEGAVQQMDATPELPLSQEEYEALLDIL*
134 >lcl|XP_002729019.1|Plus1398705..399562 NW_047602 double homeobox, 1-like LOC100362741 __SEG__ Chr20 {Rattus norvegicus} MPSDSRRPRTRLNLQQRRILVQAFERNRLPGFATREQVGQRTGLNENTIHIWFQNRRVRQARAPDQDVPASQVQDVATGGLSGKDEAAPDNLLLMAAAGGVGMENSSSSD
QPHFHEESQHPQVSLPEGRGQSQTATQAYEPGTLELLLDELLEEDQVEGDRPFPVDLDGNPGGKEHEVVQETILQLAATDCVSKESSSYSDPTNFSRESQLPQWAQPEGQ
GQEQALTQGCNRGPLELFLYQLLMQVRVETLSPGPVHLEGAVQQMHATPELPLSQEEYEALLDIL*
135 >lcl|XP_002729020.1|Plus1402243..403100 NW_047602 double homeobox, 1-like LOC100362791 __SEG__ Chr20 {Rattus norvegicus} MPSDSRRPHTRLNLQQRRILVQAFERNRLPGFATREQLGQRTGLNENTIHIWFQNRRARQARAPDQDVPASQVQDVATGGLSGKDEAAPDNLLLMAAAGGVGMENSSSSD
QPHFHEESQHPQVSLPEGRGQSQTATQAYEPGTLELLLDELLEEDQVEGDRPFPVDVDGNPGGKEHEVVQETILQLAATDCVSKESSSYSDPTNFSRESQLPQWAQPEGQ
GQEQALTQGCNRGPLELFLYQLLMQVRVETLSPGPVHLEGAVQQMHATPELPLSQEEYEALLDIL*
136 >lcl|XP_002729023.1|Plus1complement(581439..582296) NW_047602 double homeobox, 1-like LOC100363448 __SEG__ Chr20 {Rattus norvegicus} MPSDSRRPRTRLNLQQRRILVQAFERNPLPGFATREQLGQRTGLNEDTIHIWFQNRRARQARAPDQDVPASQVQDVATGGHSGKDEAAPDNLLLMAAAGGVGMENSSSRD
QPHFHEESQHPQVALPEGQSQSQTATQAYEPGTLELLLDELLEEDQVEGDRPFPVDLDGNPGGKEHGVVQETILQLAATDCVSKESSSYSDPTNFSRESQLPQWAQPEGQ
GQEQALNQGCNWGPLELFLDQLLMEVRVETLSPGPVHLEGAVQQMDATPELPLSQEEYEALLDIL*
137 >lcl|XP_002729472.1|Plus113747741..13748670 NW_047696 rCG59045-like LOC100361902 __SEG__ Chr4 {Rattus norvegicus} MNEQMKKMAKTSGQKGPGRRALDRMTLNHDEARPVQNTRVEPPHVTYTIHEEGEISPENEEDVFPNGYLECIIRGEFSEPILEEDLLFKSFESLEEAEQDLSRQVLEASS
LLECSLEYMTKGTKQEKRATQEEPQQTVGANSVPECSEYLTSRKLPVGEPSEVDLSYHEQLSGFTGEKLKGGPYCGNISMLECPQAGCKKKLRDKTALRKHMLVHGPRQH
VCAECGKAFTESSKLKRHFLVHTGERPFQCTFKGCGKRFSLDFNLCTHVRIHTGEKRFVCPFDGCEKSFIQSNNLKIHILTHAKAGKKC*
138 >lcl|XP_002729531.1|Plus16724861..6726855 NW_047713 rCG60333-like RGD1309291 __SEG__ Chr5 {Rattus norvegicus} MATELSSKCECPSCLECSQSESDWNFSSRKRGDGSSYSRLSKKSTLSPIMQRFLSQCCSNEFETANKEDFTFLTSEEESSVDFSQTQNLSQTSKKTRPLRELTIQELLRK
FGDHGKLPPHSLSLSHFRDHVVVKFRRALYYSGVWVKYVQGSGLKRHFSAQYFKRNPSSLHRLIPWLKRELTAVCGDYGYTVKNILTAILHHMTKFNLDSESFTHLLEPY
LLQYTRHFLHEFISFVYSSYNMETYDCNAIYQCPVSTWVKKKNTVSAPALSPPEDLSFMKSQQGIKQSKRSWSKTGQSSDSGLKHFPKGHSSKNSQISTTHQNTANERPV
WTKDEWGSDDFKDVVCTTNSLNWANLGESRSHTECYRNDNQEKKSESTKLLHGHVQNLKRPETSPHTFSALVDSNRAPPKKYNIRETNVLNPGQQVHDQRKEAEKKKLEE
SSLKAFQRLPRERPLINSKFRDRDHSCHCVSEDSNSPITNDKMLASTKKKMVSCSQSSQCVGVGSHHSRKTQRQYSPRTPRSKSWCVRPISRGQSYISLRESHRSKHCGL
SKRSAHGCESTYRVASLSPVHRVQACLTDRKSCKCASKGEGESQTGGHCDSLSYLRTEKCQAPNKQNMKEKHLVGRVRRIRTLRHKKPKYQCVGTQTTAELSDDLEDVNN
KSQE*
139 >lcl|XP_002729640.1|Plus1complement(1313879..1314199) NW_047754 sf3b complex subunit 1-like LOC100362972 __SEG__ Chr6 {Rattus norvegicus} MAGGVSPGTTPSTEMAGGVSPGTTPSTEMAGGVSPGTTPSTEMAGGVSPGTTPSTEMAGGVSPGTTPSTEMAGGVSPGTTPSTEMTGGVSPGTTPSTEMAGGVSPG*
140 >lcl|XP_002729693.1|Plus1complement(24986165..24986506) NW_047760 transcription elongation factor B (SIII), polypeptide 1 LOC100360990 __SEG__ Chr6 {Rattus norvegicus} MDGEKQTYGGCEGPDGMYVKLISSDGHEFIVKREHALTSGTIKAMLCDPGQFMENETTEVSFREIPSHALSKACTYFTYKAHYTNSSTEIPEFPIAPEIALELLMATNFL
DCQ*
141 >lcl|XP_002729803.1|Plus1complement(15978354..15979184) NW_047773 nuclear factor, interleukin 3, regulated-like LOC100362603 __SEG__ Chr7 {Rattus norvegicus} MNVDGLSIPNQGPSKVFWGTRRGPTTRRQREFMPEEKKDTVYWEKRRKNNEAAKRSREKRRLNDVAIEGRLAMLLEENAVLRAELQALKLQFGLLPSMCGSRMLPLQALL
WKSSWTGESHSGADSFLPLPGGHGCLFKPYSVDSGIPGCSGCLVAQGWPGLSASSRFLQESEPLSHRIVDRAFHAAFPDTVFGCHFLDRHVGTRPELKTCCGLWSPVPTG
SHAPGYSGISMASSESSMGFSPSMTCPVPGNRSEGLAQISLPHKLRIKSQLSSLLC*
142 >lcl|XP_002729875.1|Plus1complement(10172321..10172758) NW_047780 DNA-directed DNA polymerase epsilon 3 LOC100362333 __SEG__ Chr7 {Rattus norvegicus} MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDK
DKKDCEEQDKSREEEDEDEERLDEEEQNEEEEVDN*
143 >lcl|XP_002730313.1|Plus119276224..19276892 NW_048043 rCG38039-like RGD1561826 __SEG__ ChrX {Rattus norvegicus} MEEAEGSPEETQDTNKKGTSSRIRLERTCKKKFRDSQKLQKRYLLPPESVRILRDWLSKHRFNAYPTEADKQKLSKKTNLSYLQVSNWFTNARRRLLPEILQNPDISHKD
QAANAAQKQHSNPSNEVKTQLNAKSKMQDLPVPICQESQEKMSDLESYLGQKVISEGEKEKEDRNLISDPLSSPELAWPVEKPDFSNFYMLVDAAVQKAAEMEEQKKQNP
NP*
144 >lcl|XP_218196.3|Plus1complement(12844491..12845009) NW_047555 zinc finger protein 580 Znf580 __SEG__ Chr1 {Rattus norvegicus} MLLLPPRPPHPRSSSPEVMDPPPPKTPPFPKAEGPSSTSSSVAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQREATPGEPGPRKGYSCPECARVFASPLRLQSH
RVSHSDLKPFTCGACGKAFKRSSHLSRHRATHRARAGPPHTCPLCPRRFQDAAELAQHVRLH*
145 >lcl|XP_223330.5|Plus114099530..14100006 NW_047424 Btf3l4 protein-like RGD1561589 __SEG__ Chr14 {Rattus norvegicus} MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQGSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSL
TSLRKLAEQSPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN*
146 >lcl|XP_225049.1|Plus1complement(3963070..3964263) NW_047477 zinc finger protein Pegasus-like RGD1564807 __SEG__ Chr16 {Rattus norvegicus} MEEKVEPQDFLKSFREFLSQQTHCRENMLAGDLTQAQGPGAPGDVLDKSRVLMLDDFERTVDGKLQCSYCGYSSQRTARLMEHTRIHTGEKPHRCRLCPFASAYERYLEA
HMRSHTGEKPYKCELCAYRCNYGSNLSHHRRRKHNLLPLTGPRASLSSVKMWGTLQSKSNVEDGKQGVLIALTPPSVVQKPDHLSDSTHTIPNVQNGFCDSTDQTSVCRL
PRDPQGLLFVDDPLNQLSDLAGHWSTLPPENQNSISADVDSILEEWKPFVMQQPSAQGSVPQSSLILFRLSPPSSSSSLSQRDCSPLAGPSRQPSGYPSTPILGNSQPSS
PAPTLKVQGPQLLYFCQHCDTYFADNVLYTIHMGCHGYDNPFQCNICGFNCENKYDFACHFARGQHN*
147 >lcl|XP_226016.2|Plus1505823..506788 NW_047511 purine rich element binding protein A Pura __SEG__ Chr18 {Rattus norvegicus} MADRDSGSEQGGAALGSGGSLGHPGSGSGSGGGGGGGGGGGGSGGGGGAPGGLQHETQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFR
DYLGDFIEHYAQLGPSQPPDLAQAQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEG
TSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEMKKIQEKQREKRAACEQLHQQQQQQQEETTAATLLLQGEEEGEED*
148 >lcl|XP_226176.3|Plus1complement(1533992..1534447) NW_047506 RNA polymerase II, polypeptide H-like RGD1565904 __SEG__ Chr18 {Rattus norvegicus} MTAGILFEDIFDVKDIDPEGKKFDRVSQLHCESESFKVDLILDINIQIYPVDLGDKFRLVIASTLYDDDTLDDGEYNPTDGRPSRADQFEYVMYGKVYRIEGDESSTEAA
TCLSACVSYGGLLMRPQGDANNLHEFEVDSRVYLLKKKLAF*
149 >lcl|XP_226217.3|Plus1complement(2443110..2443589) NW_047531 basic transcription factor 3-like RGD1564126 __SEG__ Chr19 {Rattus norvegicus} MKEIIPNQEKLAKLQAQVCIGGKGTAPRKTVLHRTATADKKLQFSLKKLGVNNISGIEVNMFTNQGTVIHFNNPKVQASLAANTFPITGLAETKKVTEMLPSILSQLPAD
SPTSLRRRAEALPERSVDGKVPLAPGGEDDDEVPDLVENFDEASKNEAN*
150 >lcl|XP_226650.1|Plus19065396..9066475 NW_047616 Arid4a protein-like RGD1564961 __SEG__ Chr2 {Rattus norvegicus} MEGTTGVSQERSGDGDGVGAEGMKGVHVEQHFETESEGMPLLTAEPDQGIPEVTSEKSDSSAEELVHMPLKEEERVMPLIGPETLVDLDDLDERDKPSIEDVIVEGSESN
SLGSVLPDLPSVSQHSFSVALPLTSSQDESRGIKSEGDITIEVDSIAEESQEGLCERESANRSEASVASGTCGIITRERKRRAKGQKRPSDANSVLMTKKQKQTPKRTSA
AAKSEKNGAGQSSDSEDLPATDSSSNSTPVKHLNLPKPQKLPRSPARVSLLKDRGKEKHKEKPADSSPRTYKWSFQLNELDNMNSIERLSFLQEKAQEIRKHYMSLKLEV
ATIDRRRKSLKRKDREVSHTGPSSMSSAS*
151 >lcl|XP_227716.5|Plus133141859..33142650 NW_047627 neurogenin 2 Neurog2 __SEG__ Chr2 {Rattus norvegicus} MFVKSETLELKEEEEVLMLLGSASPASATLTPMSSSADEEEDEELRRPGAARGQRGAEAGQGVQGSSASGAGGCRPGRLLGLVHECKRRPSRARAVSRGAKTAETVQRIK
KTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCAGGGSLQGALFSEAVLLSPGAALGASGDSPSPSSSWSCTNSPASSS
NSTSPYSCTLSPASPGSDVDYWQPPPPEKHRYAPHLPLARDCI*
152 >lcl|XP_228426.1|Plus13838365..3845261 NW_048034 mortality factor 4 like 2-like RGD1564748 __SEG__ ChrX {Rattus norvegicus} MSSKKKGPYLCDQQFAEGDDFSKLKPSDRRVRKARSVSSPQKSTELRSLQSTLQRRRRARSVKKSHSVEKSYSEEKTCAVEKIPSTEKAYSTKKNPSAEKRRSVAKKHHT
IVKSSSTEKLLLAEKHAYAEKCLTTEKRSSAEKHPPTLKGRMTQKSASAGRHHSESHRSGKTLRFPEKSNIKENHHSSVKHSSLEKDHPEDRGRPIKKRCPTEKSQSTEK
GQLTERSSYAPATERGRPTKRSQPTKKGLSNENRHPAKKGYSAKTPGSAERDHQIERGGATDSGLSTEKDCPSRRRRPAKKSHLEEKVHSQKSSYESRVISAEKDGLAGR
VRRKRSNPSEEGHSVKCSICDSSVPSAGKDRPVRSRSDKSNPGEDRRSVESGISASRGPSAGKDSPAGRGRPNKIRRAEKGHSMEYGSSAPRGPSAGKDRPGGRGHPNKS
GPTEESRSVESDTCASKGPSTTGKERPVRRCRLNKNSLAERLCSIQCGICTPRGPSAGKHCSERRGRPNKRVPAEEDRSLKNISASRRPSGGKDRPARSRSNKSGPTKEG
WSVEGSRSTSGRPSEGKDRSGGRGRPNKSGPEKEGPSVNDSRSTSRGPSAGKDRSARRSSSNKSGPTEESLSDERDICESRGPSTGKERPARKCRLNKNSLAEQWCSIKC
GICALKQFSTRKDHSRERGRSKESGVEVGSHLVKSGVSTPRGPSAGKDLPAGRGRPNKSSPAEEGCSVKSSISASRRPSVGRDRPARSCSNKSGSAEESCSVKCGICTPK
VPSAGKDRPGGRGCPNKNSPKKEDPSVKGGRSTSRGPSAGKDRSGGRGHTNKSGPAEESRSVEGSRSTSRGPSAGKDRSGRRRHTNKSGPAEESRSVEGIRSTSRGPSAG
KDRPGRRGYPNKSSPKKEGPSVKGSRSTSRGPSAGKDRSGGRGHTNKSGSAEESHSVEGSRSTSRGPSAGKDRPGRRGYPNKSSPKKEGPSVKGSRSTSRGPSTGKDRPG
RRGYPNKNSPKKEGPSVKGSRSTSRGPSAGKDRPGGRGYPNKSSPKKEGPSVKGSRSTSRGPSAGKDRPGRRGYPNKSSPKKEGPSVKGSRSTSRGPSAGKDRPGRRGYP
NKNIPKKEGPSVKCSRNTSRGSSAGKDRPGGRGRSNKSSPTEESRSVEGSRSTSRGPSAGKDRPGRRGYPNKSSPKKEGSSVKGSRSTSRGPSAGKDRPGRRSYPNKSSP
KKEGPSVKGSRSTSRGPSAGKDRPGGRSHLNECGPEKKCPSVKDSRSTSRGPSAGKDRPGRRGRSNKSSPTEESRSVEGSRSTSRGPSAGKDRPGRRGYPNKSSPKKEGP
SVKGSRSTSRGPSAGKDHPGRRSYPNKSSPKKEGPSVKGSRSTSRGPSAGKDRPGRRGYPNKSSPKKEGPSVKGSRSTSRGPSAGKDRPGRRGYPNKNISKKEGPSVKCS
RSTSRGSSAGKDRPGGRGRSNKSSPTEESRSVEGIRSTSRGPSVGKDRPGRRGYPNKNIPKKEGPSVKCSRSTSRGSSAGKDRPGGRGRSSKSSPTEESRSVEGIRSTSR
GPSVGKDHSGKRGHPSKRGPEEEGPSFKGSRSTSRRPSVGKDRSGGRGHSNKSGPEKGDPSVKGRLSISRGSSVGKDHSGGRGHPNERGPEKEGPSAKGSRSTSRGPSVG
KDRSGGRGHSNKSGPEKEGPSVKGSRSTSRGSSVGKDRRGGRGHSNKSGPEREDPSVKGSHNTSRGPSLGKDRPGGRGHPNKSGPAEKIRSVESSTCASKEPSAGNERPA
RRYHSNKSSLAEGCCSIKSGICVPRGPSAGNDHCGRGRPNKSGSAKKSHSVEHSSNISRGPSAGKDRSTSRSGPSKKNQLAQEGPSKEKESYAKRGPSKRKEHHAGRRPN
SSQHEEEFRSFGRGKSKRGPSAGKDHPTGKGQPPKKSRPEKDSSSAERGNHAERGQSTGKDHPTDRGQPRKKSHPEEVGHSVEKGNEERKPSAGKDPHTKRGRPSKKSHP
AERHLSASMKYCPPKKHRPAENVCVKRVRSPERVHSMERGHIAKRSCLAERQLSAEEGSMAEEGCSVETDLSEERAEEGTVVDNMCSVENGHPSMEKVFLEVKPSSGSMS
RVTEPNNLQSTPEKRIDSDTNQVAQVPHCNLPVTVKIKMGVELRVPDELKSRLVEDWDLINKQKQLFQLPAEKNVDTILAEYVTFVKSQGLADNREYSVDEVVAGIREYF
NRMLGTQLLCQFEKPQYAEIHLAYPDIPMSQVYGAPHLLRLFVKIGTALANSPLNRQSLLLVSSYMHDFLEYLAENSTSLFKVSNYKVASAEYCCKAL*
153 >lcl|XP_228808.3|Plus1complement(859828..860736) NW_048038 forkhead box R2 RGD1564437 __SEG__ ChrX {Rattus norvegicus} MNVKVKNRDFWYSLHGQVPGMLDWDMGNEFFLPCTMDQCSFAEQSLAKYKIQLTKPPTLPQEKKSSFDNDGPPTEPSLWMWVNPNIVCPVNSKEPPNPIHKVLPSAAFPQ
TGESECFGTQRVAQSLSVIHTEYHQQQKLPIYSTVPHFMEEETKEQECASSKKYSKKYTMYHGPHREREAWPRPPLNYSHLVALALKSSPSCGLNVQQIYNFTRQHFPYF
RTAPEGWKNTIRHNLCSLTCFEKVPADLEDEPDGKPRSFLWKLTEEGNRFFQEDTRVLAYARRESIKQSMRQPELIDLLFHL*
154 >lcl|XP_229086.3|Plus125280015..25281472 NW_048043 Myb-like DNA-binding domain containing protein RGD1561151 __SEG__ ChrX {Rattus norvegicus} MSTCEEVSEEVAHQVVKSVFVIEDTSRNLIPCLQNGADERENHTEPLLKRPCLSPEVDSTPCISAVAFPLQEIQQSFDLVTSTVTQMAGEEVAAASMMPFQIIQNVTPHE
VFSLANVEQSIVSQTWFTGKEVKDALANQGHKWKQGMWTKEETNILMSNIEQYMKEHGVENPAEIIFKMSKGKRKDFYRSISFGLNRPLFSIYRRVIRMYDDRNHVGKYS
PEEIEKLKELWQKHGNDWITIGAAMGRSPSSVKDRWRLMKDACNAGKWTEEEEQILGDAVHELTGTEVDEKVTQGVCWATVAQQVGTRSAKQCRAKWLNYLNWKQTGGIE
WTRKDEVTLILRLAELDVADESEIRWDELAKGWESVRSPQWLRSKWWNIKRQITNHKDFAFPVLVRCLQQEYERQNASLRFWKNKSGSDMSESNPDISVQQVSFGVTSIE
DNNTSICPVPMTGSQITLQLLPRSLTDLPAAVGDSESVTLPTGPQ*
155 >lcl|XP_231064.2|Plus1complement(1692796..1693467) NW_047651 placenta specific homeobox 1 Psx1 __SEG__ Chr3 {Rattus norvegicus} MDTPQDSCQSFQKPLSLGAEVDLEQQHGGNAVVSEAGEEGNPSQRLVVRLLQGGLDQGEPAQGQLTGGKLAQEEPAQFSLTQGATGVGEEGEKMEGRHAGDGASGPEDDN
IHQEGGQCSNDQEQPQQETAIPEGSRSQQTGNSLAHQLYSHTRFTPSQLHDLERLF*ETCYPSLQTRKDVARWMGVEECDVQNWFRMRRSLFQRNRRLLLLCSLPPLPQS
KSP*
156 >lcl|XP_233185.5|Plus1complement(1608174..1609766) NW_047716 zinc finger protein 352-like Zfp352l __SEG__ Chr5 {Rattus norvegicus} MDVAETPGASQTVPCNTQPSPVESSQLVSGQSSEMPTWKKTVMASACCNPQETACTQNSTAHPGKASDFYFGEPSETASFIQQVVSAEQKSSPAGSCLMNLSSTTKSCLS
HPLKTEVLDTRKTLCNEGHWGRTLNSDKTLLIQITTMYESQWRTLGNHPVAPSGYHEGQAPNMDHLVDSVSNQTFIGDLEMEPSCNHVLYTDQFITSFSEQNPFGDQQRS
PVADNRFYADQKILPNGYQTFYEPQMSTNYQITCVCGQNVCRCQEILLSGEHLLSEYQTSGYRYDQDLIVNLQVTSPIGGEPLHDSQIPNSNFDTTSCGTKRTTSSEEDN
LAWHPETSLSSEETFLDQMRTSVDQNVYPSHNGTLKIEESLEPQVTSLSNQAPYVGESSDTSNSPLIQIQPQEISSASGLDQGQHPEIKLDLKTQSPVSLKNPHNSKRYC
CTYQGCKKSYKKSQHLKDHMKKHTGVKPYMCNKPGCDWKFFRLVDLNRHKQKHSGERPYPCPMCNKNYSRFYYLKQHLRSHIQASPTTAT*
157 >lcl|XP_233186.4|Plus11799858..1801510 NW_047716 zinc finger protein 352-like RGD1562966 __SEG__ Chr5 {Rattus norvegicus} MYKAETPVASQPGTFNPQTSPMESSQLISAQSLEMPTWNQTTMTSVYSSTPKTTSTPNSTALPEHSDFHFGEPSEAASLHQHVVSTDQTQYPTFSHEMELNSASNSRLTH
PQMIAVSDIRETAYNEDYWMKTLRSNWCESQKVVLGDNLVALCGSQADQDPNEDHLIASACDHYFRGNLEMPSSREQAYYTQMKSRNGGHLTLYETQMITANCSQNFLPN
QIINSFSEQTPFGNQHGKAVADEMFSGDQMIASHGYQAFYEHQMTDSGDYINCDGEMTSWRNQNVNRGQVKLLGGDNTLYEHQASVYAADQDLCVDHQRSSPIGDQPLYD
SQMSTLGFDTTLHVTNREKSNKENLSFHPRTISSSEEAFNWDQMKTPFVQNVYPDQLGPLNVEESLDPQVTSLSNQTPYVVVSPCPSSSFLAQRQPLESSAASSLIQGQH
PKMTSSLKTQNTHHLRPYLCAYQDCGKSYTKSHHLKDHMRKHTGEKPFVCNAPECEWKFTRLVDLLRHKNKHNRKRSYPCSMCNKSFSRLCYLRQHEKKKHSQSSPTNGT
*
158 >lcl|XP_233422.3|Plus1complement(6707250..6708734) NW_047718 forkhead box D2 Foxd2 __SEG__ Chr5 {Rattus norvegicus} MTLGSCCCEIMSSESSPAALSEPDADIDVVGGGSGGGELTARSGPRAPRDVLPHGHELPPEEAEADVAEDEEESGGCSDCEPRALGPRGAAAAAGSPGPGVQAARGATGP
GPGPGPGPPSGGAATRSPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSF
LRRRKRFKRQPLPPPHPHPHPHPELLLRGGAAAAGDPGAFLSGFAAYGAYGYGYGLALPAYGAPPPGPAPHPHPHPHAFAFAATAPCQLSVPPGRAAAPPPGPPTASVFA
SATSAPAPAPAPGSGPSPAGLPAFLGAELGCAKAFYPASLSPPAAGTAATLSSALLRQGLKTDAGGGAGGGGAGAGQRPSFSIDHIMGHGGGGAAPPGSGDGSPGSPFAA
AAGPGGQAQVLAMLTAPALTPVAGHIRLSHPGDSLLSSGPSFASKVAGLSGCHF*
159 >lcl|XP_233428.2|Plus1complement(6723818..6724678) NW_047718 forkhead box protein E3 Foxe3 __SEG__ Chr5 {Rattus norvegicus} MDAHVAFSGFPTLPSVSPSGPQPPSLAGDEPGREPEEVVGGGDSEPPAAPGPGRRRRRPLQRGKPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQN
SIRHNLTLNDCFVKVPREPGNPGKGNYWTLDPAAADMFDNGSFLRRRKRFKRTELPAPPPPPFPYAPFPPAPAPAPAPPARLFRLDSLLGLQTEPPGPLAPEPPCCAAPD
ASFPPCAAAASPPLYSPAPERLGLPAPLPAEPLLALAGSAGALGPLGAGEAYLRQPGFPPGLERYL*
160 >lcl|XP_234255.5|Plus122787475..22788962 NW_047760 insulinoma-associated 2 Insm2 __SEG__ Chr6 {Rattus norvegicus} MPRGFLVKRTKRSGSFYRTRPAEPLFPPPGPLAAPPSPEEPDPGLLGSPCLAPPQDSTEWGAGGGDGPGPSPARPAGPELRRAFLERCLRSPVSAESFPSATAFCSAAPA
AATSGEQLVPPRVPVSVPVPVPVSVPAPHGLQRRGKGAPGCPSAPAAVRKPKAVRRLSFADEVTTSPVLGLKIKEEEPGAPARALGGVRTPLGEFICQLCKQQYADPFAL
AQHRCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPRPTPACTASKPPHAPLTPPDPSLAAGKENGCLPRTEDQHPQARDSSGDGQHRDSAALPGLQALVHPEAARPQA
PYSEVILGRHGPRPSGASTGATSEVFVCPYCHKKFRRQAYLRKHLGTHETGSARATTPGFGSERTAPLTFACPLCGAHFPSADIREKHRLWHAVREELLLPALVGAPTEA
GPGGASEGSAQQIFSCKYCPSTFFSSPGLTRHINKCHPSESRQVLLLQMPLRPGC*
161 >lcl|XP_234348.1|Plus14833133..4834059 NW_047761 TBP-associated factor 8 RGD1562299 __SEG__ Chr6 {Rattus norvegicus} MADPAARPGGSRTRAGNKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYLSEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVGILPAYAK
RSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQVLREKASSQRRDVERALTRFLAKTGETQNLFKDDVSTFPLIAARSFTIP
YLTALLPSELEIQQMEEMDSLEQDEQTDTENIALHISSDESGAEKENTSVLQQNSSLSGSRNGEENIIDNPYLRPVKRPKIWRKKSLS*
162 >lcl|XP_235013.3|Plus1complement(20079914..20080351) NW_047773 achaete-scute complex homolog 4 Ascl4 __SEG__ Chr7 {Rattus norvegicus} MEKCKSAGLLALHSPLRASPLGALARREPCRVSARQDTADCARRRPCPSLPPGGVAEPAFLRQRNERERQRVRCVNEGYARLRQHLPRELAGQRLSKVETLRAAIGYIKQ
LQELLERHRPDLNSDGESKASSGASPCSSEPEERG*
163 >lcl|XP_235858.4|Plus1complement(12558153..12559340) NW_047798 upstream binding transcription factor, RNA polymerase I-like 1 RGD1304745 __SEG__ Chr8 {Rattus norvegicus} MASLDNKSLWSEIDILKLLECMKKNITSDDSRDFKASQADLDWNNIAFGRFSGEMCKQKWMEISCKLRKFRTLTELVLEAKELWTRAHKNNTIKHNPDRPKRPLTAYLRF
YREHRAKYCQMYPRYTNAQLTKVLAEEYRQLPAEAKERYVQDFKKEKRAFQEKMAQLKKKHPFSGHPKKSVVPRSHQTKDSKKSQGDMKTVKPLLNTEIPKTFSLAMQFQ
GEPRKPPMTAYHKFHQDSWSSPELRHLSFKERWVEISRLWHRVPEEMKEHYSRQAVELQKQYWMKLDLWLKGLSPAECAAYKKARATWGKGKIKLMSGDRSPKFERTEDL
QSASEKGLQAKPGEVEELLDWRTNSSETNIGHHGDFQASMEDMTDDSEDESSSNASDSSSTDEDD*
164 >lcl|XP_235881.3|Plus113137874..13139061 NW_047798 upstream binding transcription factor, RNA polymerase I-like 1 Ubtfl1 __SEG__ Chr8 {Rattus norvegicus} MASLDNKSLWSEIDILKLLECMKKNITSDDSRDFKASQADLDWNNIAFGRFSGKMCKQKWMEISCKLRKFRTLTELVLEAKELWTRAHKNNTIKHNPDRPKRPLTAYLRF
YREHRAKYCQMYPRYTNAQLTKVLAKEYRQLPAEAKERYVQDFKKEKQAFQEKMAQLKKNHPFSGHPKKSGVPRSHQTKDSKKSQGDMKTVKPLLNTEIPKTFSLAMQFQ
GEPRKPPMTAYHKFHQDSWSSPELRHLSFKERWVEISRLWHQVPEEMKEHYNRQAVELQKQYWMKLDLWLKGLSPEECAAYKKARATWGKGKIKRMSGGRSPKFGQTEDL
QSASEKGLEAKPGEVEELLDWRTNSSETNIGHHGDFQASMQDMTDDSEDESSSNASDSSSTDEDD*
165 >lcl|XP_237227.3|Plus111668872..11670080 NW_047816 RIKEN cDNA A930025D01-like RGD1562431 __SEG__ Chr9 {Rattus norvegicus} MPHLRAHEVQQLLHNKFVVVLGDSIQRAVYKDLVLLLQKDCLLSSSQLKSKGELSFEHDVLLEGGRWGRMHNGAHYREVRQFCSGRHLVRFYFLTRAYSPYVEDILQQLR
WGEYAPDLVIVNSCLWDLSRYRSNFLRNYREDLERLFQRLDQLLPSGCLVVWNTTMPVAEVVSGGFILPDASGCPSRLREDVMEANFYSSVEAARHGFDVLDLHFHFRHA
GQHRLSDGVHWDERAHRYLSQLLLAHVADAWGVILPAHNTVGRWIRDVPAERQPDRADRRQPRDHHHCEQREPPGARHSPSSRYHHHHTPQRSSSHPRNLPSRREDRIPS
SPTSQPQPFHRDSSRRRHGYSREVNSVDREHRPGPIRRVYSHHEIRASSPYPSRHHSEPHRSHRRHSHHRHT*
166 >lcl|XP_344145.4|Plus14266347..4266913 NW_047395 rCG45930-like Ascl5 __SEG__ Chr13 {Rattus norvegicus} MNSNFCRALVDRGSPGGIQLGVVAPAGPTPLAATEPLGNVPFLLYPGHSEPSYYDAYTGVFPYVPFPGAFGVYDYPFEPAFIQKRNERERQRVKCVNEGYARLRGHLPGA
LAEKRLSKVETLRAAIRYIKYLQELLSAAPDGAPPTATSPPPAHAGHGNALQPPSLVAESSGSSFSPSPFLESEEPSL*
167 >lcl|XP_344595.1|Plus116489702..16491024 NW_047491 SRY-box containing gene 4 Sox4 __SEG__ Chr17 {Rattus norvegicus} MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIQ
EAERLRLKHMADYPDYKYRPRKKVKSGNTGAGSAATAKPGEKGDKVAGGSGHAGSGHAGGGAGGSSKPAPKKSCGPKVAGSSVGKPHAKFVPAGGGKAAASFSPEQAALL
PLGEPAAVYKVRTPSAATPAASSSPSSALATPAKHPADKKVKRVYLFGSLGASASPVGGLGASADPSDPLGLYEDGGPGCSPDGRSLSGRSSAASSPAASRSPADHRGYA
SLRAASPAPSSAPSHASSSLSSSSSSSSGSSSSDDEFEDDLLDLNPSSNFESMSLGSFSSSSALDRDLDFNFEPGSGSHFEFPDYCTPEVSEMISGDWLESSISNLVFTY
*
168 >lcl|XP_345444.4|Plus125023046..25024578 NW_047658 insulinoma-associated 1 Insm1 __SEG__ Chr3 {Rattus norvegicus} MPRGFLVKRSKKSTPVSYRVRGGEDCDRALLLSPGCGGARAEPPVPSPGPLPPPPPPALAERAHAALAAALACAPGPPPPPPGPRAAHFGNPEAAHPAFLYSPTRPVSRE
HEKHKYFERSFNLGSPVSAESFPTPAALLAGGGGGANGAGGGGGGTCGGDALLFAPAELKMGTAFSAGAEAARGPGPGPPLSPAAALRPPGKRPAAPAAVAAEPPAKAAK
APSAKKPKAIRKLHFEDEVTTSPVLGLKIKEGPVEAPRGRAGGATRPLGEFICQLCKEEYADPFALAQHKCSRIVRVEYRCPECAKVFSCPANLASHRRWHKPRPAPAAA
RAPEPEAATRAEAREAAGGGGSSDRDTPSPGGVSESGSEDGLYECHHCAKKFRRQAYLRKHLLAHHQALXXXXXXXXXXXXXXXXXKAPQEAYGGRRGGRRAGP*VRPPS
ATCAQCAGRPSPARAPRSATCACCTLPRCSPASTARPPSTAPPA*RGTSTSATRLRIDR*SSFRCPCVRPA
169 >lcl|XP_345446.2|Plus1complement(25907185..25908651) NW_047658 NK2 transcription factor related, locus 4 (Drosophila) Nkx2-4 __SEG__ Chr3 {Rattus norvegicus} MSLSPKHTTPFSVSDILSPIEETYKKFGGVMDGAPPGLGAPLGAAAYRAPPTGPSSQAAAVAGMQPPHAMAGHNAAAAAAAAAAAAAAAATYHMPPGVSQFPHSAMGSYC
NGGLGNMGELPAYTDGMRGGAAAAATGWYGANTDPRYSSSERGQKRGTEGRLAARAFPATAGARGCWRSSQRRPRADARGVLGRGLGLVRGSGSRFGTRRAAWDARGFLG
DPWGARGLPGPWARGESGARAAALEGSRDAVGAPVPSLKASGATAGAVLAGSGLTGRPFWAPSPVSRFMGPSAGVNVAGMGSLTGIADAAKSLAPLHAAAPRRKRRVLFS
QAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQLQQEGGLGPPPPPPPPSPRRVAVPVLVKDGKPCQNGAGTPTPGQGGQQPQAP
TPASELEELSSSPPALHGPGGGLAALDTATGDYGGGVLGANLLYGRTW*
170 >lcl|XP_345495.3|Plus16703..>9750 NW_047680 schnurri-like RGD1307116 __SEG__ Chr3 {Rattus norvegicus} METSEPTHPPPSSTDQQASVPGIPGGPGGQASPRLTLGPVILPPEQGLAPTVFLKAWPVPLYHTVPPGGLQPRAPLVTGSLEGASVPFILSPLLQPEGPSATQVGKPATP
ALTVNIVGTLPVLSPGVGSALVSTGRVKSTGKYLCPHCGRDCLKPSVLEKHIRSHTGERPFPCPTCGIAFKTQSNLYKHRRTQTHLNNSRLSLESEGSGSSLLEEGDRPG
ETASVDSRGDEGAPERALSPSVHPTLAAQNRERKVDSLGATLSHREASVDQTQMVSPEFPLASPQPRRKLPEPKPGFLQRQQETCSEKPWDPRALEGQLRKCESTDSGYL
SRSDSVEQPPVASSPLHSLSEHSAESEGEGGPGCSSSGNRAEQGTPGPSLEIEKKKLEERIALLISHNQAVVDDPQLDHVRPRKTVLSKQGSIDLPMPYTYKDSFHFDIR
ALEPSRRRVALSPALSTFTPLEKARPLFFHSVPTQLSTTVECVPVTRSNSLPFVEGSKLWPEPPRDSQDAVPGVQKALSPRLTSARLGCRPGLTLASIPSGHPRALVRQA
AVEDLPCTPTGDPSAVAEDPDGKRAVAKEGVAYKGRASKKCSQRKQRMFSQEKWQVYGNETFKRIYQKMKTNHQGRQKHREVKPAQGTELGLPPPQEQIGGSDDAGLSQD
NRIPILGDTTAGAKPGSWRSRPSLEDSLEAESLKQLKAVARVKSSPTLGSTDGLCLSGKSPLLSPSGKLDLGHQLPPMPGPCQGRDLEAPETASPDPSGEVIKETSPGVQ
TVLRRSSGGSVAPQLAEDKLPSERKRLKVEGLDHQEQPGPLETETSGGSVQADPQPSQKQDSDPREVLGCSNKSILHVSTAPEPSDVSSAASAVALRCLGLEDQDSLLPS
VSRTPGLHSLLPAQLQDPGVPTAQSGVSFAPKYLLRLPQGENPLSLVAPGSGKGSDSLCTSTQPVEQALLVGSELGMLQPPGAYSGSGEAGGSPKDPSWSKSRDEKEEAQ
TGREKRDRTSDSIRGTRRSPDPRTST
171 >lcl|XP_345847.2|Plus1complement(8309518..8310603) NW_047780 Mafa homolog Mafa __SEG__ Chr7 {Rattus norvegicus} MAAELAMGAELPSSPLAIEYVNDFDLMKFEVKKEPPEAERFCHRLPPGSLSSTPLSTPCSSVPSSPSFCAPSPGTGSSAGGGGSAAQAGGAPGPPSGGPGTVGGASGKAV
LEDLYWMSGYQHHLNPEALNLTPEDAVEALIGSGHHSAHHGAHHPAAAAAYEAFRGQSFAGGGGGGADDMGAGHHHGAHHTAHHHHSAHHHHHHHHHHGGSGHHGGGAGH
GGGGAGHHVRLEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDLYKEKYEKLAGRGG
PGGAGGAGFPREPSPAQAGPGAAKGAPDFFL*
172 >lcl|XP_345976.3|Plus13041006..3042130 NW_047801 forkhead box L2 Foxl2 __SEG__ Chr8 {Rattus norvegicus} MMASYPEPEDTAGTLLSPESGRAVKEAEASPPSPGKGGGTAPEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIK
VPREGGGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAHFQPGKGLFGSGGGAGGCGVPGAGADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMPYASCQMAAAA
AAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGPYSRVQSMALPPGVVNSYNGLGGPPAAPPPPPPPHPHPHPHAHHLHAAAAPPPAPPHHGAAAPPPGQLSPASPATAAP
PAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLDL*
173 >lcl|XP_573106.1|Plus133792755..33793243 NW_047334 basic transcription factor 3-like RGD1559667 __SEG__ Chr10 {Rattus norvegicus} MKETIMNQEKLAKLQAQGRMGGKGTARRKEKVVPRTATADDKKLQFSLKKLGVNSISGIEEVNVFTNQGTVIHFNNPKVQASLAANTFPMTGHAETKQLTEMLPSILKQL
GADGLTSLRRPAEARPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN*
174 >lcl|XP_573272.3|Plus11671700..1672332 NW_047356 high mobility group protein B2-like RGD1564519 __SEG__ Chr11 {Rattus norvegicus} MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHR
PKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEVGKKGPGRPTGSKKKNEPEDEEEEEEEEDDEDEEEEDEDEE*
175 >lcl|XP_573521.1|Plus111234548..11235036 NW_047399 similar to basic transcription factor 3 RGD1563812 __SEG__ Chr13 {Rattus norvegicus} MKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNSISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQL
GADSLTSLRRLAEALPKQSVDGKAPLAAGEEEEDEVPDLVENFDEASKNEAN*
176 >lcl|XP_573625.1|Plus11786664..1787293 NW_047428 high mobility group protein B2-like RGD1561694 __SEG__ Chr14 {Rattus norvegicus} MGKGDPNKPRGKMSLYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKARYDREMKNYVPPKGNKKGKKKDPNAPKRPPSAFFLFCSEHR
PKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEVGKKGPGRPTGSKKKNEPEDEEEEEEEDGEDEEEEDEDEE*
177 >lcl|XP_573745.1|Plus1367816..369387 NW_047451 similar to REST corepressor 2 RGD1565031 __SEG__ Chr15 {Rattus norvegicus} MPSVMEKPSAGSGILSRSRAKTAPNGGQPHSEDDSSEEEHSHDSMIRVGTNYQAVIPECKPESPARYSNKELKGMLVWSPNHCVSDAKLDKYIAMAKEKHGYNIEQALGM
LLWHKHDVEKSLADLANFTPFPDEWTVEDKVLFEQAFGFHGKCFQRIQQMLPDKLIPSLVKYYYSWKKTRSRTSVMDRQARRLGGRKDKEDSDELEEGRGAVSEGEPDTG
DPKREPLPSRPLNARPGPGKKEIQVSQYRHHPLRTRRRPPKGMYLSPEGLTAVSGSPDLANLTLRGLDSQLISLKRQVQSMKQTNSSLRQALEGGIDPLRPPEANTKFNS
RWTTDEQLLAVQAIRRYGKDFGAIAEVIGNKTLTQVKTFFVSYRRRFNLEEVLQEWEAEQDGAPTAPVPVEEARRGAPVPATALEEDDEVQITSVSTSVPRSVPPAPPPP
PPPTSLSQPPPLLRPPLPTAPTLLRQPPPLQQGRFLQPRLAPNQPPPPLIRPALAASRHSARPGPQPPPTLVGAQLEPPAPSL*
178 >lcl|XP_573888.1|Plus1complement(2876807..2877145) NW_047470 transcription elongation factor B (SIII), polypeptide 1 RGD1565815 __SEG__ Chr16 {Rattus norvegicus} MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVCYTNSSTEIPEFPIAPKIALELLMAVNSL
DC*
179 >lcl|XP_574397.1|Plus1complement(5121863..5124289) NW_047556 enhancer of polycomb homolog 2-like RGD1561337 __SEG__ Chr1 {Rattus norvegicus} MSKLSFRARALDAAKPLPIYRGKDMPDLNDCVSINRAVPQMPTGMEKEEESEHHLQRAISAQQVFREKNESMVIPVPEAESNVNYYNRLYKGEFKQPKQFIHIQPFNLDN
EQPDYDMDSEDETLLNRLNRKMEVKPLQFEIMIDRLEKASSNQLVTLQEAELLLNEDDYLIKAVYDYWVRKSKNCRGPSLIPQIKQEKRDGSTNNDPYVAFRRRTEKMQT
RKNRKNDEASYEKMLKLRREFSRAITILEMIKRREKTKRELLHLTLEVVEKRYHLGDYGGEILNEVKVNRSEKELYASPATLHNGNHHKVQECKTKHPHHLSLKEEASDV
VRQKKKHPKKPKAEAVLAPPQPTPETVPVINKSDIKQYDFQSSDEDEFPQVPSPSSEPEEENDPDGPCAFRRRAGCQYYAPRLDQANNHPCKSSELADLDKLRYKHCLTT
LTVPRRCIGFARRRIGRGGRVIMDRISTEHDPVLKQIDPEMLNGLSSSSQTIDFSSNFSRTNASSKPCENRLSLSEILSNIRSCRLQCFQPRLLNVQDIDSEEYTSRKPG
QTVSSKRVSAASVALLNTSKNGISVTGGITEEQFQTHQQQLAQMQRQQLAQLQQKQQSQHSSQQTHPKAQGSSTSDCMSKTLDSASAHFAASAVVSAPVPSRSEGSKEQN
TGHNNMNGVVQPSGPSKTLYSTNMALSSSPGISAVQLVRTVGHTTTNHLIPALCTSSPQTLPMNNSCLTNAVHLNNVSVVSPVNVHINTRTSAPSPTALKLATVAASMDR
VPKVTPSSAISSIARENHEPERLGLNGIAETTVAMEVT*
180 >lcl|XP_574777.2|Plus1complement(571109..571966) NW_047602 double homeobox, 1-like RGD1560095 __SEG__ Chr20 {Rattus norvegicus} MPSDSRRPRTRLNLQQRRILVQAFERNPLPGFATREQLGQRTGLNEDTIHIWFQNRRARQARAPDQDVPASQVQDVATGGLSGKDEAAPDNLLLMAAAGGVGMENSSSSD
QPHFHEESQHPQVALPEGRGQSQTATQAYEPGTLELLLDELLEEDQVECDRPFPVDLDGNPGGKEHGVVQETILQLAATDCVSKESSSYSDPTNFSRESQIPQWAQPEGQ
GQEQALTQGCNRGPLELFLDQLLMEVRVETLSPGPVHLEGGGQQMDATPELPLSQEEYEALLDIL*
181 >lcl|XP_574778.2|Plus1complement(575032..575889) NW_047602 double homeobox, 1-like RGD1564734 __SEG__ Chr20 {Rattus norvegicus} MPSDSRRPRTRLNLQQRRILVQAFERNPLPGFATREQLGQRTGLNEDTIHIWFQNRRARQARAPDQDVPASQVQDVATGGHCGKDEAAPDNLLLMAAAGGVGMENSSSRD
QPHFHEESQHPQVALPEGQSQSQTATQAYEPGTLELLLDELLEEDQVEGDRPFPVDLDGNPGGKEHGVVQETILQLAATDCVSKESSSFSDPTNFSRESQLPQWAQPEGQ
GQEQALTQGCNRGPLELFLDQLLMEVRMETLSPGPVHLEGAVQQMDATPELPLSQEEYEALLDIL*
182 >lcl|XP_575275.3|Plus1876200..876913 NW_047659 TGFB-induced factor homeobox 2-like RGD1560115 __SEG__ Chr3 {Rattus norvegicus} MSNSDLGEDEGLLSLTGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSS
PSLLAVSVPAPTNMLSLSVCSMPLHSGQGEKPAASFPQVELESPKALVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKDDFSSFQLLVEVALQRAAEMELQKQQDX
APPLLHTPLPLVSENAK*
183 >lcl|XP_575873.3|Plus17070655..7071980 NW_047717 forkhead box protein D3 Foxd3 __SEG__ Chr5 {Rattus norvegicus} MTLSGSGSASDMSGQTVLTAEDVDIDVVGEGDDGLEEKDSDAGCDSPAGPPDLRLDEADEGLPASAHHGQSQPQALALPSEATGPGNDTGAPEADGCKGGEDAVTGGGGP
GAGGGATGGLTPNKPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSF
LRRRKRFKRHQQEHLREQTALMMQSFGAYSLAAAASAGPYGRPYGLHPAAAAGAYSHPAAAAAAAAAAALQYPYALPPVAPVCRQPCPCCPRASWPQSGRSARSRSEPSA
PAQHPGRRRGSRGHGGRRGHHVAHQVRAQCAAVVQH*EHXXXXXXXXXXXXXXXXXQSDALNVHAPAPVDERDDCHHRAHSERAAVRTVHATRSLSRSRCGSRSASQVAR
AI
184 >lcl|XP_577938.1|Plus1386127..386984 NW_047602 double homeobox, 1-like RGD1564977 __SEG__ Chr20 {Rattus norvegicus} MPSDSRRPRTRLNLQQRRIQVQAFERNPLPGFATREQLGQRTGLNEDTIHIWFQNRRARQARASDQDVPALQVQDVATGGLSGKDEAAPDNLLLMAAAGGVGMENSSSSD
QPHFHEESQHPQVALPEGRGQSQTVTQAYEPGTLELLLDELLEEDQVEGDRPFPVDVDGNPGGMEHEVVQETILQLAATDGVSNESSSYSNPTNFSRESQLPQWAQPEGQ
GQEQALTQGCNRGPLELFLDQLLMQVRVETLSPGPVHLEGAVQQMHATPGLPLSQEEYEALLDIL*
185 >lcl|XP_580253.2|Plus1complement(11374826..11376316) NW_047626 hypothetical protein Lor __SEG__ Chr2 {Rattus norvegicus} MSHQKKQPTPCPPVGCGKTSGGGGGGGGGYYSGGGSGGGSSCGGGSSGGGSGCGGGGGGGGSYGGGSSCGGGGGSGGGVKYSGGSSGGSSCGGGYSGGGGGSSCGGGYSG
GGGGSSCGGGYSGGGGGGSSCGGGYSGGGGSSCGGGGYSGGGSSCGGGGGSGGGVKYSGGSGGGGGSSCGGGYSGGGGGSSCGGGSGGGGSYCGGSSGGGSSGGCGGGSG
GGKYSGGGGGGGSSCGGGYSGGGGSGGGSSCGGGYSGGGGSSCGGGGYSGGGGSSCGGGSSGGGGGGSSGSSQQYQCQSYGGGSSGGSSCGGGYSGGGGSSCGGGYSGGG
GSSCGGGSSGGGSSCGGGSGGGYSGGGGGSCGGGSSGGGGGYYSSQQSSQTSCAPQQSYGGGSSGGGGSCGGGSSGGGGGGSGGCYSSGGGGGSGGCGGGYSGGGGGCGG
GSSGGSGGGCGGGYSGGGGGGSSCGGGSSGGGSGGGKGVPVCHQTQQKQAPTWPCK*