SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ptro K    

ID / Description / Sequence
1 >lcl|NP_001008988.1|Plus14555729..4556343 NW_001252928 sex-determining region Y protein SRY __SEG__ ChrY {Pan troglodytes} MQSYASAMLSVFNSDDYSPAVQQNIPALRRSSSFLCTESYNSKYQRETGENSKDSVQDRVKRPMNAFFVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFF
QEAQKLQAMHREKYPNYKYRPRRKANMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL*
2 >lcl|NP_001009014.1|Plus1complement(5907..7160) NW_003467353 forkhead box D4-like 4 FOXD4L4 __SEG__ Chr7 {Pan troglodytes} MNLPRAERLRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQQFLEQSLQPGLQVARWGGVALPREHIEGGGGPSDPSEFGTKFRAPPRSAAASEDARQPAKPP
YSYIALITMAILQNPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLRRRKRFKRHQLTPGAHLPHPFP
LSAAHAALHNPRPGPLLGAPAPPQPVPGAYPNTAPGRRP*ALLHPHPLRYLLLSAPVYAGAPKKAEGADLATPAPFPCCSPHLVLSLGRRARVWRRHREADASLSALRVL
CKGSGERVQGLRRVCPRPRGATATCSSDHQACCIPKPLPLCCKCPPPPLLVQFCSNSSSIRRRTAPTAALPPRARCWAGTCRPRRRC*
3 >lcl|NP_001009050.2|Plus1complement(15871598..>15871951) NW_003457175 twist-related protein 1 TWIST1 __SEG__ Chr7 {Pan troglodytes} GGVGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGA
WSMSASH*
4 >lcl|NP_001009067.1|Plus1208217..208942 NW_003459076 homeobox protein TGIF2LX TGIF2LX __SEG__ ChrX {Pan troglodytes} MEAAADGPAETQSPVQKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILP
DMLQQHRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPSGPDSVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSITSPSSPELVSPEEYADFSSFLLL
VDAAVQRAAELELEKKQEPNP*
5 >lcl|NP_001012434.1|Plus114053941..14055011 NW_003456973 protein atonal homolog 1 ATOH1 __SEG__ Chr4 {Pan troglodytes} MSRLLHAEDWAEVKELGDHHRQPQPHHLPQPPPPLPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELSASEAAAPRDEVDGRGELVRR
SSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTP
SGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENS
KTSPRSHRSDGEFSPHSHYSDSDEAS*
6 >lcl|NP_001065253.1|Plus1complement(1933668..1934294) NW_003457988 zinc finger protein 500 ZNF500 __SEG__ Chr16 {Pan troglodytes} MEWYRVLSARCQGPGHLLPGQRPAPVRGLVRPDQPRGGPPPGRRASHGADKPYTCPECGKGFSKTSHLTKHQRTHTGERPYKCLVCGKGFSDRSNFSTHQRVHTGEKPYP
CPECGKRFSQSSSLVIHRRTHSGERPYACTQCGKRFNNSSHFSAHRRTHTGEKPYTCPACGRGFRRGTDLHKHQRTHMGAGSLPTLQPVAPGGPSAKA*
7 >lcl|NP_001092032.1|Plus1complement(709825..710691) NW_003459107 mortality factor 4-like protein 2 MORF4L2 __SEG__ ChrX {Pan troglodytes} MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVE
SEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMS
QVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL*
8 >lcl|NP_001103676.1|Plus14496160..4496921 NW_003458540 major prion protein preproprotein preproprotein PRNP __SEG__ Chr20 {Pan troglodytes} MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMK
HMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDQYSSQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYER
ESQAYYQRGSSMVLFSSPPVILLISFLIFLIVG*
9 >lcl|NP_001129105.1|Plus1complement(15750182..15751003) NW_003456887 zinc finger protein 80 ZNF80 __SEG__ Chr3 {Pan troglodytes} MSPKRDGLGTDDGLHSQVLQEQVSTGDNLHECDSQGRSKDTLVREEKTYKCKECGNVFNKNSLLVRHQQIHTGVKPYEYQECGKAFPEKVDFVRHMRIHTGEKPCKCVEC
RKVFNRRSHLLCYRQIHTGENPYECSECGKTFSYHSVFIQHRVTHTGEKLFGCKECGKTFYYNSSLTRHMKIHTGEKPCKCSECGKTFTYHSVFFRHSMTHTSGKPYECK
ECGKGFYYSYSLTRHTRSHTGEKPYECLEHRKAFGYHSAFAQQSKIHSGGKNL*
10 >lcl|XP_001135162.1|Plus1693164..694243 NW_003456883 POU domain, class 5, transcription factor 1 isoform 2 POU5F1 __SEG__ Chr3 {Pan troglodytes} MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGA
SPEPCTVTPGAVKLEKKLEQNPEESQDIKALQKELEQSAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVDEADNNENLQEIC
KAETLVQARKRKRTSIENRVRGNLENLFRQCPKPTLQQISHIAQQLGLEKDVVRAWFCNRRQKGKRSSSDYAQREDFEAAGSSFSGGPVSFPLAPGPYFGTPGYGSPHFT
ALYSSVPFPEGEAFRPVSVTTLGSPMHSN*
11 >lcl|XP_001135265.1|Plus187682..88233 NW_003457014 putative TAF11-like protein ENSP00000332601-like LOC471807 __SEG__ Chr5 {Pan troglodytes} MPRGLKGSNKDRIPEELDGNLEEPRDQESELRSQDVMDLTEGDNEASASAPPAAKRQKTDTKGKKERKPTVDAEEAQRMTALLSAMSEEQLARYEVCRRSAFPKARIAAL
MQSISGRSVSENTAIAMAGIAKVFVGEVVEEALDVCEMWGETPPLQPKHLREAVRRLKPKGLFPNSNYKKIMF*
12 >lcl|XP_001135452.1|Plus1complement(430126..432201) NW_003457936 zinc finger protein 770 ZNF770 __SEG__ Chr15 {Pan troglodytes} MMAENNLKMLKIQQCVVANKLPRNRPYVCNICFKHFETPSKLARHYLIHTGQKPFECDVCHKTFRQLVHLERHQLTHSLPFKCSICQRHFKNLKTFVKHQQLHNETYQNN
VKQVRRLLEAKQEKSMYGVYNTFTTEERWALHPCSKSDPMYSMKRRKNIHACTICGKMFPSQSKLDRHVLIHTGQRPFKCVLCTKSFRQSTHLKIHQLTHSEERPFQCCF
CQKGFKIQSKLLKHKQIHTRNKAFRALLLKKRRTESRPLPNKLNANQGGFENGEIGESEENNPLDVHSIYIVPFQCPKCEKCFESEQILNEHSCFAARGGKIPSRFKRSY
NYKTIVKKILAKLKRARSKKLDNFQSEKKVFKKSFLRNCDLISGEQSSEQTQRTFVGSLGKHGTYKTIGNRKKKTLTLPFSWQNMGKNLKGILTTENILSIDNSVNKKDL
SICGSSGEEFFNNCEVLQCGFSVPRENIRTRHKICPCDKCEKVFPSISKLKRHYLIHTGQRPFGCNICGKSFRQSAHLKRHEQTHNEKSPYASLCQVEFGNFNNLSNHSG
NNVNYNASQQCQAPGVQKYEVSESDQMSGVKAESQDFIPGSTGQPCLPNVLLESEQSNPFCSYSEHQEKNDVFLYRCSVCAKSFRSPSKLERHYLIHAGQKPFECSVCGK
TFRQAPHWKRHQLTHFKERPQGKVVALDSVM*
13 >lcl|XP_001135750.1|Plus11705447..1706502 NW_003458792 transcription elongation factor A N-terminal and central domain-containing protein isoform 2 TCEANC __SEG__ ChrX {Pan troglodytes} MSDKNQIAARASLIEQLMSKRNFEDLGNHLTELETIYVTKEHLQETDVVRAVYRVLKNCPSVALKKKAKCLLSKWKAVYKQTHSKARNSPKLFPVRDNKEENSGPSHDPS
QNETLGICSSNSLSSQDVAKLSEMIVPENRATQLKPKEEHFGDGDPESTGKRSSELLDPTTPMRTKCIELLYAALTSSSTDQPKAGLWQNFAREIEEHVFTLYSKNIKKY
KTCIRSKVANLKNPRNSHLQQNLLSGTTSPREFAEMTVMEMANKELKQLRASYTESCIQEHYLPQVIDGTQTNKIKCRRCEKYNCKVTVIDRGTLFLPSWVRNSNPDEQM
MTYVICNECGEQWYHSKWVCL*
14 >lcl|XP_001135887.1|Plus138623..39417 NW_003458538 zinc finger protein 524 isoform 1 ZNF524 __SEG__ Chr19 {Pan troglodytes} MDTPSPDPLPSPLPGEEEKPLALPPPVPRGRRGRRPGGATSSNRTLKASLPRKRGRPPKSGQEPPLVQVQGVTAPVGSSGGSDLLLIDDQGVPYTVSEGSAAGPEGSGPR
KAPHFCPVCLRAFPYLSDLERHSISHSELKPHQCKVCGKTFKRSSHLRRHCNIHAGLRPFRCPLCPRRFREAGELAHHHRVHSGERPYQCPICRLRFTEANTLRRHAKRK
HPEAMGVPLCAPDPGSEPPWDEEGIPATAGAEEEDETEGKGEPA*
15 >lcl|XP_001136023.1|Plus1complement(8522..9199) NW_003457187 elongation factor 1-beta-like LOC736213 __SEG__ Chr7 {Pan troglodytes} MGFGDLKSPTGLQVLNDYLADKSYIKGYVPSQADVAVFEAVSGPRPADLCHALRWYNHIKSYEKEKAGLPGVKKALSKYGPADVEDTTGSGATDSKDDDDIDLFGSDYEE
ESEEAKRLREEHLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPGGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVA
AFNKI*
16 >lcl|XP_001136101.2|Plus1complement(393580..394413) NW_003457108 zinc finger protein 79-like isoform 1 LOC736280 __SEG__ Chr6 {Pan troglodytes} MRVLNVARHSVVVHTLLSIKEFTLVRSPIHVLNVERLLVRTHILLYIRESILERNLMNAMNVVGPLVRVHILLNIKECIQEKNPMNVMNVRKPSMITQLLFNIILSILQR
NPMNIMTGKTFSYCSDLIQHQRMHTGEKPYKCNECGNAFSDCSALIQHQRTHTGEEPYECKQCGKAFSRSTYLTQHQRSHAGEKQYKCNECEKTFSLSSFLTQHMRVQTG
EKPYKYNEYGKAFSDCSGHFQRTHTGEKPCECNDCGKPFSFCSALIQHKRIHTRKKP*
17 >lcl|XP_001137232.1|Plus1complement(12898..14589) NW_003458538 zinc finger protein 579 isoform 1 ZNF579 __SEG__ Chr19 {Pan troglodytes} MDPQPPPPAQGSPPHRGRGRGRGRGRGRGRGRGRGGAGAPRAPLPCPTCGRLFRFPYYLSRHRLSHSGLRPHACPLCPKAFRRPAHLSRHLRGHGPQPPLRCAACPRTFP
EPAQLRRHLAQEHAGGEVELAIERVAKETAEPSWGPQDEGSEPPTTAAAGATEEEAVAAWPETWPAGEPSTLAAPTSAAEPRESESEEAEAGAAELRAELALAAGRQEEK
QVLLQADWTLLCLRCREAFATKGELKAHPCLRPEGEQEGEGGPPPRPKRHQCSICLKAFARPWSLSRHRLVHSTDRPFVCPDCGLAFRLASYLRQHRRVHGPLSLLAPLP
AAGKKDDKASGARNSAKGPEGGEGAECGGASEGGEGGQNGGDAAPARPPAGEPRFWCPECGKGFRRRAHLRQHGVTHSGARPFQCVRCQREFKRLADLARHAQVHAGGPA
PHPCPRCPRRFSRAYSLLRHQRCHRAELERAAALQALQAQAPTSPPPPPPPLKAEQEEEGLPLPLANIKEEPPSPGTPPQSPPAPPVFLSASCFDSQDHSAFEMEEEEVD
SKAHLRGLGGLAS*
18 >lcl|XP_001137373.1|Plus1complement(384278..385060) NW_003459223 transcription factor E2F6-like LOC737667 __SEG__ ChrX {Pan troglodytes} MWSAPAITIRINSKDDVPPESKRETVNMKPHNKTSLACTTRKFIDILKSAPGGVLSLSQVAAKLAVHRRRIYDIISVLQGVKLIEKTSKNHIQWIGPDFNSGATPEEKKL
EEELSKLSATEDALDKLIEDCSQQLCELTNDTVLGKLAYVTYEDIHNLERFQEQTVFVAKLPVEITLEIPISEDSLSLRLSNNDGPVDAYLCISKKDYEANYTSEGAGTS
SEGAGTSSESAGTSSESRHPEHPEEEENPQQGEELLDMSN*
19 >lcl|XP_001137881.1|Plus184796..85380 NW_003458538 zinc finger protein 581 isoform 1 ZNF581 __SEG__ Chr19 {Pan troglodytes} MPSPCPQLKTFSSVETMERTPLRTYRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVK
PFECDICGKAFKRASHLARHHSIHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP*
20 >lcl|XP_001139046.1|Plus1complement(1106158..1107432) NW_003457478 zinc finger and BTB domain-containing protein 6 isoform 2 ZBTB6 __SEG__ Chr9 {Pan troglodytes} MAAESDVLHFQFEQQGDVVLQKMNLLRQQNLFCDVSIYINDTEFQGHKVILAACSTFMRDQFLLTQSKHVRITILQSAEVGRKLLLSCYTGALEVKRKELLKYLTAASYL
QMVHIVEKCTEALSKYLEIDLSMKNNNQHTDLCQSSDPDVKNEDENSDKDCEIIEISEDSPVNIDFHVKEEESNALQSTVESLTSERKEMKSPELSTVDIGFKDNEICIL
HVESISTAGVENGQFSQPCTSSKASMYFSETQHSLINSTVESRVAEVPGNQDQGLFCENTEGSYGTVSEIQNLEEGYSLRHQCPRCPRGFLHVENYLRHLKMHKLFLCLQ
CGKTFTQKKNLNRHIRGHMGIRPFQCTVCLKTFTAKSTLQDHLNIHSGDRPYKCHCCDMDFKHKSALKKHLTSVHGRSSGEKLSRPDLKRQSLL*
21 >lcl|XP_001139199.1|Plus13918752..3919738 NW_003457014 POU domain, class 5, transcription factor 2 POU5F2 __SEG__ Chr5 {Pan troglodytes} MAGHRPSNHFCPLPASGEGGPRGPMPLRVDTLTWLSTQAAPGRVMVWPAVRPGVCPGPEVWRIPLGPLPHEFRGWIAPCRPRLGASEAGDWLRRPSEGALPGPYIALRSI
PKLPPPEDISGILKELQQLAKELRQKRLSLGYSQAEVGIAVGALFGKVLSQTTICRFEAQQLSVANMWKLRPLLKKWLEEVEAENLLGLCKMEMILQQSGKWRRASRERR
IGNSLEKFFQRCPKPTPQQISHIAGCLQLQKDVVRVWFYNRSKMGSRPTNDASPREIMGTAGPPRPGAPVCFHLGLGLPVDIPHYTRLYSAGVAHSSAPATTLGLLRF*
22 >lcl|XP_001141426.1|Plus15878697..5878918 NW_003457529 SS18-like protein 2-like LOC739816 __SEG__ Chr10 {Pan troglodytes} MSVDWLRGKVEVNQETIQRLLEENDQLIRCIVEYQNKGGANECVQCQLMLHRNLIYLATIADASPTSTSKAME*
23 >lcl|XP_001142826.1|Plus1complement(4986900..4987718) NW_003456974 neurogenin-2 isoform 2 NEUROG2 __SEG__ Chr4 {Pan troglodytes} MFVKSETLELKEEEDVLVLLESASPALAALTPLSSSADEEEEEEPGASGGARRQRGAEAGQGARGGVAAGAEGCRPARLLGLVHYCKLRPSRARAVSRGGQTAHTVQRIK
KTRRLKANIRKRNRMHNLNAALALLREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGGLPGALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSP
APSSSVSSNSTSPYSCTLSPASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI*
24 >lcl|XP_001144246.1|Plus17905657..7907189 NW_003458541 insulinoma-associated protein 1 INSM1 __SEG__ Chr20 {Pan troglodytes} MPRGFLVKRSKKSTPVSYRVRGGEDGDRALLLSPSCGGARAEPPAPSPVPEPLPPPPPAERAHAALAAALACAPGPQPPPQGPRAAHFGNPEAAHPAPLYSPTRPVSREH
EKHKYFERSFNLGSPVSAESFPTPAALLGGGGGGGASGAGGGGTCGGDPLLFAPAELKMGTAFSAGAEAARGPGPGPPLPPAAALRPPGKRPPPPTAAEPPAKAVKAPGA
KKPKAIRKLHFEDEVTTSPVLGLKIKEGPVEAPRGRAGGAARPLGEFICQLCKEEYADPFALAQHKCSRIVRVEYRCPECAKVFSCPANLASHRRWHKPRPAPAAARAPE
PEPAARAEAREAPGGGSDRDTPSPGGVSESGSEDGLYECHHCAKKFRRQAYLRKHLLAHHQALQAKGAPPAPPAEDLLALYPGPDEKAPQEAAGDGEGAGVLGLSASAEC
HLCPVCGESFASKGAQERHLRLLHAAQVFPCKYCPATFYSSPGLTRHINKCHPSENRQVILLQVPVRPAC*
25 >lcl|XP_001145191.1|Plus1complement(225..443) NW_003471628 rhombotin-2-like LOC742169 __SEG__ Chr11 {Pan troglodytes} LFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI*
26 >lcl|XP_001148697.2|Plus155891..56475 NW_003458462 methyl-CpG binding domain protein 3-like 1 isoform 1 MBD3L1 __SEG__ Chr19 {Pan troglodytes} MAKSSQRKQRDCANQCKSNPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAGELLSTLDLANTLQKLVPSYTGGSLLEDLA
SGLEHSCPMPHLACSSDAVEIIPGEGVGISQLLCKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGCPEKR*
27 >lcl|XP_001148793.1|Plus12357215..2357703 NW_003456851 transcription factor BTF3-like isoform 1 LOC739023 __SEG__ Chr2B {Pan troglodytes} MKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQL
GADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEAFKNEAN*
28 >lcl|XP_001148941.2|Plus1<7..300 NW_003476237 zinc finger protein 627-like LOC743430 __SEG__ Chr19 {Pan troglodytes} CKQCGKAFSCSSSFRKHERIHTGEKPYKCTKCGKAFSRSSYFRIHERTHTGEKPYECKQCGKAFSRSTYFRVHEKIHTGEKPCENPNPNASVVPVLS*
29 >lcl|XP_001151979.1|Plus1complement(2490156..2491040) NW_003458195 nucleophosmin isoform 3 NPM1 __SEG__ Chr16 {Pan troglodytes} MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVH
ISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTP
RSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL*
30 >lcl|XP_001152323.2|Plus1complement(6219..6803) NW_003471733 putative RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like protein 2-like LOC745880 __SEG__ Chr11 {Pan troglodytes} MLSSTLRVAVVCVSNVNRSMEAHSILRRKGLSVRSFGTESHVRLPGPRPDRPVVYDFATTYKEMYNDLLRKDRECYTRNGILHILGRNERIKPGPERFQDCTDFFDVIFT
CEESVYDTVVEDLCSREQQTFQPVHVINMDIQDTLEDATLGAFLISEICQCLQQSDDMEDNLAELLLQMEEKAGKSFLHTVCFY*
31 >lcl|XP_001152448.1|Plus121461..22045 NW_003471735 putative RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like protein 2-like LOC745932 __SEG__ Chr11 {Pan troglodytes} MLSSTLRVAVVCVSNVNRSMEAHSILRRKGLSVRSFGTESHVRLPGPRPDRPVVYDFATTYKEMYNDLLRKDRECYTRNGILHILGRNERIKPGPERFQDCTDFFDVIFT
CEERVYDTVVEDLCSREQQTFQPVHVINMDIQDTLEDATLGAFLISEICQCLQQSDDMEDNLAELLLQMEKKAGKSFLHTVCFY*
32 >lcl|XP_001152517.1|Plus1complement(2636..3220) NW_003471736 putative RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like protein 2-like LOC745955 __SEG__ Chr11 {Pan troglodytes} MLSSTLRVAVVCVSNVNRSMEAHSILRRKGLSVRSFGTESHVRLPGPRPDRPVVYDFATTYKEMYNDLLRNDRECYTRNGILHILGRNERIKPGPERFQDCTDFFDVIFT
CEERVYDTVVEDLCSREQQTFQPVHVINMDIQDTLEDATLGAFLISEICQCLQQSDDMEDNLEELLLQMEEKAGKSFLHTVCFY*
33 >lcl|XP_001152650.1|Plus1complement(7826..8410) NW_003471736 putative RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like protein 2-like LOC745998 __SEG__ Chr11 {Pan troglodytes} MLSSTLRVAVVCVSNVNRSMEAHSILRRKGLSVRSFGTESHVRLPGPRPHRPVVYDFATTYKEMYNDLLRKDRECYTRNGILHILGRNERIKPGPERFQDCTDFFDVIFT
CEERVYDTVVEDLCSREQQTFQPVHVINMDIQDTLEDATLGAFLICEICQCLQQSDDMEDNLEELLLQMEEKAGKSFLHTVCFY*
34 >lcl|XP_001152663.1|Plus13822021..3822353 NW_003457719 prothymosin alpha-like isoform 2 LOC465294 __SEG__ Chr12 {Pan troglodytes} MSDAVVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNANEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDKDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD
*
35 >lcl|XP_001152902.1|Plus1701..1285 NW_003471740 putative RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like protein 2-like LOC746101 __SEG__ Chr11 {Pan troglodytes} MLSSTLRVAVVCVSNVNRSMEAHSILRRKGLSVRSFGTESHVRLPGPRPHRPVVYDFATTYKEMYNDLLRKDRECYTRNGILHILGRNERIKPGPERFQDCTDFFDVIFT
CEERVYDTVVEDLCSREQQTFQPVHVINMDIQDTLEDATLGAFLICEICQCLQQSDDMEDNLEELLLQMEEKAGKSFLHTVCFY*
36 >lcl|XP_001152962.1|Plus113342..13926 NW_003471740 putative RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like protein 2-like LOC746131 __SEG__ Chr11 {Pan troglodytes} MLSSTLRVAVVCVSNVNRSMEAHSILRRKGLSVRSFGTESHVRLPGPRPHHPVVYDFATTYKEMYNDLLRKDRECYTRNGILHILGRNERIKPGPERFQDCTDFFDVIFT
CEERVYDTVVEDLCSREQQTFQPVHVINMDIQDTLEDATLGAFLISEICQCLQQSDDMEDNLAELLLQMEEKAGKSFLHTVCFY*
37 >lcl|XP_001153086.1|Plus1complement(18699..19283) NW_003471740 putative RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like protein 2-like LOC746182 __SEG__ Chr11 {Pan troglodytes} MLSSTLRVAVVCVSNVNRSMEAHSILRRKGLSVRSFGTESHVRLPGPRPHRPVVYDFATTYKEMYNDLLRKDRECYTRNGILHILGRNERIKPGPERFQDCTDFFDVIFT
CEERVYDTVVEDLCSREQQTFQPVHVINMDIQDTLEDATLGAFLISEICQCLQQSDDMEDNLEELLLQMEEKAGKSFLHTVCFY*
38 >lcl|XP_001153201.1|Plus1complement(13783..14367) NW_003471741 putative RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like protein 2-like LOC746228 __SEG__ Chr11 {Pan troglodytes} MLSSTLRVAVVCVSNVNRSMEAHSILRRKGLSVRSFGTESHVRLPGPRPHRPVVYDFATTYKEMYNDLLRKDRECYTRNGILHILGRNERIKPGPERFQDCTDFFDVIFT
CEERVYDTVVEDLCSREQQTFQPVHVINMDIQDTLEDATLGAFLICEICQCLQQSDDIEDNLEELLLQMEEKAGKSFLHTVCFY*
39 >lcl|XP_001153255.1|Plus16584..7168 NW_003471742 putative RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like protein 2-like LOC466329 __SEG__ Chr11 {Pan troglodytes} MLSSTLRVAVVCVSNVNRSMEAHSILRRKGLSVRSFGTESHVRLPGPRPDRPVVYDFATTYKEMYNDLLRKDRECYTRNGILHILGRNERIKPGPERFQDCTDFFDVIFT
CEERVYDTVVEDLCSREQQTFQPVHVINMDIQDTLEDATLGAFLISEICQCLQQSDDMEDNLEELLLQMEEKAGKSFLHTVCFY*
40 >lcl|XP_001153532.1|Plus192883..94895 NW_003458508 zinc finger protein 526 isoform 3 ZNF526 __SEG__ Chr19 {Pan troglodytes} MAEVVAEVAEMPTQMSPGAVEMSTPMSAEMMEMSTEVTEMTPGEALASSLFFQHHQFMCSECGSLYNTLEEVLSHQEQHMLAVSEEEALTTQNVGLEPELVPGAEGPFQC
GECSQLILSPGELLAHQDAHLRESANQIQYQCWDCQELFPSPELWVAHRKAQHLSATVAEPPVPPPLPPPTPLPPPSPPSEVKMEPYECPECSTLCATPEEFLEHQGTHF
DSLEKEERNGLEEEEEDDEEEDEDDEETEDEEAMAEVGDDAVGGDESTAGWAQGCGDCPQHQPSAGARRQHRRTAHSPASAAHPFHCSQCQRSFSSANRLQAHGRAHVGG
THECTTCSKVFKKAASLEQHLRLHRGEARYLCVDCGRGFGTELTLVAHRRAHTANPLHRCRCGKTFSNMTKFLYHRRTHAGKSGTPPTGATAPPAPAEPTPPPPPPAPPA
QLPCPQCSKSFASASRLSRHRRAVHGPPERRHRCGVCGKGFKKLIHVRNHLRTHTGERPFQCHSCGKTFASLANLSRHQLTHTGARPYQCLDCGKRFTQSSNLQQHRRLH
LRPVAFARAPRLPITGLYNKSPYYCGTCGRWFRAMAGLRLHQRVHARARTLTLQPPRSPPPAPPPPPEPQQTIMCTELGETIAIIETSQPLALEDTLQLCQAALGASEAG
GLLQLDTAFV*
41 >lcl|XP_001154081.1|Plus1complement(786492..787484) NW_003458553 forkhead box protein S1 FOXS1 __SEG__ Chr20 {Pan troglodytes} MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRR
RRRFTRRTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPTEPKEISTPKPACPGELPVATSSSSCPAFGF
PAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE
*
42 >lcl|XP_001154170.1|Plus1complement(19151021..19151359) NW_003457175 transcription elongation factor B polypeptide 1 TCEB1 __SEG__ Chr7 {Pan troglodytes} MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFL
DC*
43 >lcl|XP_001154654.1|Plus1complement(2192826..2195300) NW_003457528 protein DLN-1-like LOC740363 __SEG__ Chr10 {Pan troglodytes} MGDLKSGFEEVDGVRLGYLIIKGKQMFALSQVFTDLLKNIPRTTVHKRMDHLKVKKHHCDLEELRKLKAINSIAFHAAKCTLISREDVEALYTSCKTERVLKTKRRRVGR
ALATKAPPPERAAAASPRPGFWKDKHQLWRGLSGAARPLPISAQSQRPGAAAARPAAHLPQIFSKYPGSHYPEIVRSPCKPPLNYETAPLQGNYVAFPSDPAYFRSLLCS
KHPAAAAAAAAATCLERFHLVNGFCPPPHHHHHHHHHHHHHHHHHREQPPQKSHHPPHHQRPQPHLGSFPESCSSDSESSSYSDHAANDSDFGSSLSSSSNSVSSEEEEE
EGEEEEEEEEEEEEGGSGASDSSEVSSEEEDSSTESDSSSGSSQVSVQSIRFRRTSFCKPPSVQAQANFLYHLASAAAATKPAAFEDAGRLPDLKSSVKAESPEEWNLQS
WAPKASPVYCPASLGSCFAEIRNDRVSEITFPHSEISNAVKRTDLTINCLAEGASSPSPKTNNAFPQQRILREARKCLQTTPTTHCADNNTIAARFLNNDSSGAEANSEK
YSKILHCPEFATDLPSSQTDPEVNAAGAAATKAENPCTDTGDKTLPFLHNIKIKVEDSSANEEYEPHLFTNKLKCECNDTKGEFYSVTESKEEDALLTTAKEGFACPEKE
TPSLNPLAQSQGLSCTLGSPKPEDGEYKFGARVRKNYRTLVLGKRPVLQTPPVKPNLKSARSPRPTGKTETHEGTLDDFTVINRRKKVASNVASAVKRPFHFMANFPCPP
SLIIGRDGDLWPAYSLNTTKDSQTPHKAHPIWKWQLGGSAIPLPPSHKFRKFNS*
44 >lcl|XP_001156719.1|Plus1complement(32133849..32136785) NW_003457279 e3 ubiquitin-protein ligase Topors isoform 1 TOPORS __SEG__ Chr9 {Pan troglodytes} MASAAKEFKMDNFSPKAGTSKLQQTVPADASPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRR
FRYRTTMTRERNASVYSPSGPVNRRTTTPPDSGVLFEGLGISTRPRDVEIPQFMRQIAVRRPTTADERSLRKIQEQDIINFRRTLYRAGARVRNIEDGGRYRDISAEFFR
RNPACLHRLVPWLKRELTVLFGAHGSLVNIVQHIIMSNVTRYDLESQAFVSDLRPFLLNRTEHFIHEFISFARSPFNMAAFDQHANYDCPAPSYEEGSHSDSSVITISPD
EAETQELDINVATVSQAPWDDETPGPSYSSSEQVHVTMSSLLNTSDSSDEELVTGGTTSQIQGVQTNDDLNNDSDDSSDNCVIVGFVKPLAERTPELVELSSDSEDLGSY
EKMETVKTQEQEQSYSSGDSDVSRCSSPHSVLGKDEQINKGHCDSSTRIKSKREEKRSTSLSSPRNLNSSVRGDRVYSPYNHRHRKRGRSRSSDSRSQSRSGHDQKNHRK
HHGKKRMKSKRSRSRESSRPRGRRDKKRSRTRDSSWSRRSQTLSLSSESTSRSRSRSSDHGKRRSRSRNRDRYYLRNNYGSRYKWEYTYYSRNKDRDGYESSYRRRTLSR
AHYSRQSSSPEFRVQSFSERTNARKKNNHSERKYYYYERHRSRSLSSNRSRTASTGTERVRNEKPGGKRKYKTRHLEGTNEVAQPSREFASKAKDSHYQKSSSKLDGNYK
NESDTFSDSRSSDRETKHKRRKRKTRSLSVEIVYEGKATDTTKHHKKKKKKHKKKHKKHHGDNASRSPVVITIDSDSDKDSEVKEDTECDNSGPQDPLQNEFLAPSLEPF
ETKDVVTIEAEFGVLDKECDIATLTNNLNNANKTVDNIPPLAASVEQTLDVREESTFVSDLENQPSNIVSIQTEPSRQLPSPRTSLMSVCLGRDCDMS*
45 >lcl|XP_001159506.2|Plus1<9..575 NW_003476377 zinc finger protein 682-like LOC748060 __SEG__ Chr19 {Pan troglodytes} KPYKCKECGKAFNHCSLLTIHERTHTGEKPYKCEECGKAFNSSSILTEHKVIHSGEKPYKCEKCDKVFKRFSYLTKHKRIHTGEKPYKCEECGKAFNWSSILTEHKRIHT
GEKPYNCEECGKAFNRCSHLTRHKKIHTAVKRYKCEECGKAFKRCSHLNEHKRVQRGEKSCKYKKCGEAFNHCSNLTT*
46 >lcl|XP_001159837.1|Plus1complement(13748668..13750374) NW_003456638 zinc finger protein 648 ZNF648 __SEG__ Chr1 {Pan troglodytes} MAQVDSQDRWGEGSPLSSLTEEAHDTQMLSMNLESDDEDGGEAEKEGTADPVACPRGSSPVTHENPDLPWPHPLGKEEEKFSDSSSAGGMGQKPVEMSGKASWNRDVTKI
KETQGSPGASRALGTLPSGLAHKLLGQMQPLGDRLPAGDDGDSRANQDAVLDVPSSFPSNGKYLCAHKSVDTCAGNSSLLCFPRPGSNWDLPTQETHTPAQASATPASLA
AAVLAKARNSRKVQNQAGRREGGEAEARPYRCLRGGRAFQKPSDPLSPAETRGGAAKRYACELCGKAYSHRGTLQQHRRLHTGERPYQCSFCDKAYTWSSDHRKHIRTHT
GEKPYPCPDCGKAFVRSSDLRKHQRNMHSNNKPFPCSECGLTFNKPLSLLRHQRTHLGAKPFRCPACDREFAVASRMVEHQRVHSGERPFPCPTCGKCFTKSSNLSEHQT
LHTGQRPFKCADCGVAFAQPSRLVRHQRIHTGERPFPCTQCGQAFARSSTLKRHQQIHSGEKGFLCAECGRAFRIASELAQHIRMHNGERPYQCEDCGQAFTRSNHLQRH
RAKHGTCKKEPIPSSSDE*
47 >lcl|XP_001160061.1|Plus12030132..2030716 NW_003457667 putative RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like protein 2-like LOC748182 __SEG__ Chr11 {Pan troglodytes} MLSSTLRVAVVCVSNVNRSMEAHSILRRKGLSVRSFGTESHVRLPGPRPHRPVVYDFATTYKEMYNDLLRKDRECYTRNGILHILGRNERIKPGPERFQECTDFFDVIFT
CEERVYDTVVEDLCSREQQTFQPVHVINMDIQDTLEDATLGAFLICEICQCLQQSDDMEDNLAELLLQMEEKAGKSFLHTVCFY*
48 >lcl|XP_001160103.1|Plus110172..10756 NW_003457668 putative RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like protein 2-like LOC748195 __SEG__ Chr11 {Pan troglodytes} MLSSTLRVAVVCVSNVNRSMEAHSILRRKGLSVRSFGTESHVRLPGPRPHRTVVYDFATTYKEMYNDLLRKDRECYTRNGILHILGRNERIKPGPERFQDCTDFFDVIFT
CEERVYDTVVEDLCSREQQTFQPVHVINMDIQDTLEDATLGAFLICEICQCLQQSDDMEDNLAELLLQMEEKAGKSFLHTVCFY*
49 >lcl|XP_001162286.1|Plus1complement(16625145..16625336) NT_106996 keratin-associated protein 19-4 KRTAP19-4 __SEG__ Chr21 {Pan troglodytes} MSYYGSYYRGLGYGCGGFGGLGYGYGCGCGSFRRLGYGCGFGGNGYGCCRPSCYGGYGFSQFY*
50 >lcl|XP_001162325.1|Plus1complement(16630067..16630285) NT_106996 keratin-associated protein 19-5-like LOC745572 __SEG__ Chr21 {Pan troglodytes} MNYYGNYYGGLGYGYGGFDDLGYGYGCGCGSFRRLGYGGGYGGYGYGSGFGGYGYRSCRPSCYGGYGFSGFY*
51 >lcl|XP_001162366.1|Plus1complement(16701686..16701874) NT_106996 keratin-associated protein 6-2-like LOC745625 __SEG__ Chr21 {Pan troglodytes} MCGSYYGNYYGDHGYGCCGYEGLGYGYGSLGCGYGSCCGYGYGYGSRFFCGCGYGCGSGYYY*
52 >lcl|XP_001162448.1|Plus116738283..16738480 NT_106996 hypothetical protein LOC745730 KRTAP20-2 __SEG__ Chr21 {Pan troglodytes} MCYYSNHYGGLRCGYGGLGGGYGCGCGYGHGYGGLGCGYGRGYGGYGYGCCRPSCYGRYWSCGFY*
53 >lcl|XP_001162510.1|Plus1complement(655609..656088) NW_003458488 transcription factor jun-D JUND __SEG__ Chr19 {Pan troglodytes} METPFYGDEALSGLGGGASGSGGRFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQS
NGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGVFS*
54 >lcl|XP_001162708.1|Plus1complement(17140204..17140395) NT_106996 keratin-associated protein 19-8-like KRTAP19-8 __SEG__ Chr21 {Pan troglodytes} MSYYRSYYGGLGYGYGGFGGWGYGYGCGYGSFRRLGYGCGYGGYGFSCCRPLYYGGYGFSTFY*
55 >lcl|XP_001165749.2|Plus1<1235..1816 NW_003476524 putative methyl-CpG-binding domain protein 3-like 3-like LOC749125 __SEG__ Chr19 {Pan troglodytes} GKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFQRPVTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAAGTASE
SLDRAGAERVHSTLEPTPGQFPAVAGGPTPGMGCQLPPPLSGQLVTPAVIRRQARRVKKARERLAKALQADRLARQAEMLTCR*
56 >lcl|XP_001166748.1|Plus1complement(28065965..28066978) NW_003457175 neurogenic differentiation factor 6 isoform 2 NEUROD6 __SEG__ Chr7 {Pan troglodytes} MLTLPFDESVVMPESQMCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEEEEEDREEEDENGLPRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGL
NDALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGCLQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELTTPP
GHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFPYDLHLRSQSLTMQDE
LNAVFHN*
57 >lcl|XP_001168598.1|Plus117519583..17520437 NW_003456693 protein atonal homolog 8 ATOH8 __SEG__ Chr2A {Pan troglodytes} MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGLRDRTHRLQPVPVPVPVPVPVAPAVPPRGGTDTAGERGGSRAPEVSDARKR
CFALGAVGPGLPTPPPPPPPPPPAPQSQATGGPEAQPFREPGLRPRILLCAPPARPAPSAPPAPPAPESTVRPAPPTRPGESSYSSISHVIYNNHPDSSASPRKRPGEAT
AASSEIKALQQTRRLLANARERTRVHTISAAFEALRKQVPAPRRTPSLRRGTTAGMGGRVAGAG*
58 >lcl|XP_001169802.2|Plus11110..1631 NW_003474165 high mobility group protein B1-like LOC749557 __SEG__ Chr15 {Pan troglodytes} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYR
PKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKG
59 >lcl|XP_001171781.2|Plus1complement(16716691..16716906) NT_106996 keratin-associated protein 6-1 KRTAP6-3 __SEG__ Chr21 {Pan troglodytes} MCGSYYGNYYGTPGYGFCGYGGLGYGYGGLGCGDGSCCGCGFRRLGCGYGYGSRSLCGYGYGCGSGSGYYY*
60 >lcl|XP_001171930.1|Plus14710811..4711212 NW_003456635 helix-loop-helix protein 1 NHLH1 __SEG__ Chr1 {Pan troglodytes} MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKK
LSKIEILRLAICYISYLNHVLDV*
61 >lcl|XP_001173168.2|Plus1complement(3145..3825) NW_003463273 hypothetical protein LOC750130 LOC750130 __SEG__ Chr3 {Pan troglodytes} STGHATPLPVTSPSSVPTGDTTPLPVTDTSSVSRGDTTSLPVTSPSSASTGDITPLPVTDASSVSTGDTTPLPVTDASSVSTALATPLPVTSPSSASTGDTTPLPVTDAS
SVSTGHATSLPVTDASSPSTGDTTPLPVTSPSSASTGHATPLPVTDASSVSTGHATPLPVTSASSASTGDTTPVPLSSATSASTVSSDSPLKMETSGSCHLPGLYLSQWA
PWRNSA*
62 >lcl|XP_001173171.2|Plus13113803..3114657 NW_003456525 zinc finger protein 691 isoform 3 ZNF691 __SEG__ Chr1 {Pan troglodytes} MGSEKEQSPEPHLPEEGEGGKPWRVDDSEGSWIPPGEKEHGQESLSDELQETHPKKPWQKVTVPARELGDPIAHPRHEADEKPFICAQCGKTFNNTSNLRTHQRIHTGEK
PYKCSECGKSFSRSSNRIRHERIHLEEKHYKCPKCQESFRRRSDLTTHQQDHLGKRPYRCDICGKSFSQSATLAVHHRTHLEPAPYICCECGKSFSNSSSFGVHHRTHTG
ERPYECTECGRTFSDISNFGAHQRTHRGEKPYRCTVCGKHFSRSSNLIRHQKTHLGEQAGKDSS*
63 >lcl|XP_001173335.1|Plus123085024..23085842 NW_003457102 activator of basal transcription 1 ABT1 __SEG__ Chr6 {Pan troglodytes} MEAEESEKAATEQEPLEGTEQTLDAEEEQEESEEAACGSKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWV
EFRDKRIAKRVAASLHNTPMGARRRSPFRYDLWNLKYLHRFTWSHLSEHLAFERQVRRQRLRAEVAQAKRETDFYLQSVERGQRFLAADGDPARPDGSWTFAQRPTEQEL
RARKAARPGGRERARLATAQDKARSNKGLLARIFGAPPPSESMEGPSLVRDS*
64 >lcl|XP_001174611.2|Plus1complement(2158701..2160869) NW_003458524 zinc finger protein 600 isoform 3 ZNF600 __SEG__ Chr19 {Pan troglodytes} MMKEVLSTGQGNTEVIHTGTLQRHQSYHIGDFCFQEIEKEIHDIEFQCQEDERNGHEAPMTKIKKLTGSTDQHDHRHAGKKPIKDQLGSSFYSHLPELHIIQIKGKIGNQ
FEKSTNDAPSVSTSQRSSRRPQIHISNNYGNNPLNSSLLPQKQEVHMREKSFQCNESGKAFNCSSLLRKHQIPHLGDKQYKCDVCGKLFNHKQYLTCHRRCHTGEKPYKC
NECGKSFSQVSSLTCHRRLHTGVKSHKCNECGKIFGQNSALVIHKAIHTGEKPYKCNECDKAFNQQSNLARHRRIHTGEKPYKCEECDKVFSRKSTLESHKRIHTGEKPY
KCKVCDTAFTWNSQLARHKRIHTGEKTYKCNECGKTFSHKSSLVCHHRLHGGEKSYKCKVCDKAFAWNSHLVRHTRIHSGGKPYKCNECGKTFGQNSDLLIHKSIHTGEQ
PYKYEECEKVFSCESTLETHKIIHTGEKPYKCKVCDKAFACHSYLAKHTRIHSGEKPYKCNECSKTFRLRSYLASHRRVHSGEKPYKCNECSKTFSQRSYLHCHRRLHSG
EKPYKCNECGKTFSHKPSLVYHRRLHTGEKSYKCTVCDKAFVRNSYLARHTRIHTAEKPYKCNECGKAFNQQSQLSLHHRIHAGEKLYKCETCDKVFSRKSHLKRHRRIH
PGKKPYKCKVCDKTFGSDSHLKQHTGLHTGEKPYKCNECGKAFSKQSTLIHHQAVHGVGKLD*
65 >lcl|XP_003308320.1|Plus12024..3397 NW_003456578 Krueppel-like factor 5-like LOC748934 __SEG__ Chr1 {Pan troglodytes} MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQAQPAPAQAPQPAQPPATGPRLPPEELVQTRCEMEKYLTPQLPPVPIIPERK
KYRRDSASVIDQFFTDTEGLPYSINMNVFLPDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPPAPTQALPEFTSIFSSHQTAAPEVHNIFIKQELPTPDLHLS
VPTQQGHLYQLLNTPDLDMPSSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQGMPPCTYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAA
TIASKLAIHNPNLPTTLPVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGVCNR
SFSRSDHLALHMKRHQN*
66 >lcl|XP_003308343.1|Plus14210761..4211168 NW_003456608 helix-loop-helix protein 2 NHLH2 __SEG__ Chr1 {Pan troglodytes} MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPD
KKLSKIEILRLAICYISYLNHVLDV*
67 >lcl|XP_003308627.1|Plus1complement(1372878..1373663) NW_003456637 zinc finger protein 664 ZNF664 __SEG__ Chr1 {Pan troglodytes} MIYKCPMCREFFSERADLFMHRKIHTAEKPHKCDKCDKGFFHISELHIHWRDHTGEKVYKCDDCGKDFSTTTKLNRHKKIHTVEKPYKCYECGKAFTWSSHLQIHMRVHT
GEKPYVCSECGRGFSNSSNLCMHQRVHTGEKPFKCEECGKAFRHTSSLCMHQRVHTGEKPYKCYECGKAFSQSSSLCIHQRVHTGEKPYRCCGCGKAFSQSSSLCIHQRV
HTGEKPFKCDECGKAFSQSTSLCIHQRVHTKERNHLKISVI*
68 >lcl|XP_003308889.1|Plus1991295..992863 NW_003456666 zinc finger protein 238 isoform 1 ZNF238 __SEG__ Chr1 {Pan troglodytes} MEFPDHSRHLLQCLSEQRHQGFLCDCTVLVGDAQFRAHRAVLASCSMYFHLFYKDQLDKRDIVHLNSDIVTAPAFALLLEFMYEGKLQFKDLPIEDVLAAASYLHMYDIV
KVCKKKLKEKATTEADSTKKEEDASSCSDKVESLSDGSSHMAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTE
SLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQVKVEKEASCDESDVGTNDYDMEHSTVKESVSTNNRVQYEPAHLAPLREDSVLRELDRED
KASDDEMMTPESERVQVEGGMESSLLPYVSNILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGIRSKPAADVNVPTCSLCGKTFSCMYTLKRHERTHSGEKPYTC
TQCGKSFQYSHNLSRHAVVHTREKPHACKWCERRFTQSGDLYRHIRKFHCELVNSLSVKSEALSLPTVRDWTLEDSSQELWK*
69 >lcl|XP_003309396.1|Plus1complement(12337257..12338327) NW_003456849 neurogenic differentiation factor 1 NEUROD1 __SEG__ Chr2B {Pan troglodytes} MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEEDSLRNGGEEEDEDEDLEEEEEEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARE
RNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNQDMPPHLPTASASFPVHPYS
YQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPI
DNIMSFDSHSHHERVMSAQLNAIFHD*
70 >lcl|XP_003309596.1|Plus13076923..3077405 NW_003456857 twist-related protein 2-like isoform 1 TWIST2 __SEG__ Chr2B {Pan troglodytes} MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLA
ARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH*
71 >lcl|XP_003309780.1|Plus1954428..955354 NW_003456876 zinc finger protein 620 isoform 2 ZNF620 __SEG__ Chr3 {Pan troglodytes} MVGGLPGNVSQHLDFGSSLEQPQGHWIIKTKSKRRHFTDTSARHHEAYEVKNGEKFEKLGKNISVSTQLTTNQTNPSGQISYECGQCGRYFIRMADFHQHEKCHTGEKSF
ECKECGKYFRYNSLLIRHQIIHTGKKPFKCKECGKGLSSDTALIQHQRIHTGEKPYECKECGKAFSSSSVFLQHQRFHTGEKLYECNECWKTFSCSSSFTVHQRMHTGEK
PYECKECGKRLSSNTALTQHQRIHTGEKPFECKECGKAFNQKITLIQHQRVHTGEKPYECKVCGKTFSWCGRFILHQKLHTQKTPVQA*
72 >lcl|XP_003309805.1|Plus15049749..5050744 NW_003456876 zinc finger protein 660 ZNF660 __SEG__ Chr3 {Pan troglodytes} MRRKTRNFNHKTVKDNKVLTEGSDQESEKDNSQCCDPATNERVQAEKRQYVCTECGKAFSQSANLTVHERIHTGEKPYKCKECGKAFSHSSNLVVHRRIHTGLKPYTCSE
CGKSFSGKSHLIRHQGIHSGEKTYECKECGKAFSRSSGLISHHRVHTGEKPYTCIECGKAFSRSSNLTQHQRMHRGKKVYKCKECGKTCGSNTKIMDHQRIHTGEKPYEC
DECGKTFILRKTLNEHQRLHRREKPYKCNECGKAFTSNRNLVDHQRVHTGEKPYKCNECGKTFRQTSQVILHLRTHTKEKPYKCSECGKAYRYSSQLIQHQRKHNEEKET
S*
73 >lcl|XP_003310007.1|Plus1complement(2820848..2821336) NW_003456887 transcription factor BTF3-like LOC740175 __SEG__ Chr3 {Pan troglodytes} MKETIMNQEKLAKLQAQVCIGGKGTARRRKKVVHRTATADDKKLQFSFKKLGVNNIFGIEEVHMFTNQGTVIHFNNPKVQAFLAANTFTITGHAETKQLTEMLPNILNQL
GVDSLNSLSRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN*
74 >lcl|XP_003310074.1|Plus110328524..10332111 NW_003456893 zinc finger and BTB domain-containing protein 38 ZBTB38 __SEG__ Chr3 {Pan troglodytes} MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNVLAASSLYFKNIFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETVTDLAAA
GKKLGISFLEDLTDRNFSNSPGPYVFCITEKGVVKEEKNEKRHEEPAITNGPRITNAFSIIETENSNNMFSPLDLRASFKKVSDSMRTASLCLERTDVCHEAEPVRTLAE
HSYAVSSVAEAYRSQPVREHDGSSPGNTGKENCEALAAKPKTCRKPKTFSIPQDSDSATENIPPPPVSNLEVNQERSPQPAAVLTRSKSPNNEADVHFSREDENQSSDVP
GPPAAEVPPLVYNCSCCSKAFDSSTLLSAHMQLHKPTQEPLVCKYCNKQFTTLNRLDRHEQICMRSSHMPIPGGNQRFLENYPTIGQNGGSFTGPEPLLSENRIGEFSST
GSTLPDTDHMVKFVNGQMLYSCVVCKRSYVTLSSLRRHANVHSWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCIFCLETFMTYYILKNHQKSFHAIDHRLSISKK
TANGGLKPSVYPYKLYRLLPMKCKRAPSKSYRNSSYENARENSQMNESAPGTYVFQNPHSSELPTLNFQDTVYTLTNSPAIPLETYACQDIPTSANVQNAEGTKWGEEAL
KIDLDNNFYSTEVSVSSTENAVSSDLRAGDVPVLSLSNSSENAASVISYSGSAPSVIVHSSQFSSVIMHSNAIAAMTSSNHRAFSDPAVSQSLKDDSKPEPDKVGRFASR
PKSIKEKKKTTSHTRGEIPEESNYVADPGGSLSKTTNIAEETSKIETYIAKPALPGTSTNSNVAPLCQITVKIGNEAIVKRHILGSKLFYKRGRRPKYQMQEEPLPQGND
PEPSGDSPLGLCQSECMEMSEVFDDASDQDSTDKPWRPYYNYKPKKKSRQLKKMRKVNWRKEHGNRSPSHKCKYPAELDCAVGKAPQDKPFEEEETKEMPKLQCELCDGD
KAVGAGNQGRPHRHLTSRPYACELCAKQFQSPSTLKMHMRCHTGEKPYQCKTCGRCFSVQGNLQKHERIHLGLKEFVCQYCNKAFTLNETLKIHERIHTGEKRYHCQFCF
QRFLYLSTKRNHEQRHIREHNGKGYACFQCPKICKTAAALGMHQKKHLFKSPSQQEKIGDMCHENSNPLENQHFIGSEDNDQKDNIQTGVENVVL*
75 >lcl|XP_003310496.1|Plus1complement(2720482..2720748) NW_003456974 heat shock factor-binding protein 1-like LOC100611896 __SEG__ Chr4 {Pan troglodytes} MGTREIAETDPKNEQELTSVVQKLLQQIQNKFQTMSDQITGRTDDMSSCTDDLEKNIADLVTQAGVEELESKNKIPATQEVKVANNLY*
76 >lcl|XP_003310639.1|Plus121556303..21557235 NW_003456991 zinc finger protein 42 homolog LOC471381 __SEG__ Chr4 {Pan troglodytes} MNQQLKKRAKTRHQKGLGGRTPSGAKPRQGKTSQDLQAEIEPVSAVWALCDGYVCYEPGPQALGGDDFSDCYIECVIRGEFSQPILEEDSLFESLEYLKKGSEQQLSQKV
LEGSSLECSLEYMKKGVKKELPQKIVGENSLEYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARKKPPINKEYDSLSAIACPQSGCTRKLRNRAALRKHLLIHGPRDHVCA
ECGKAFVESSKLKRHFLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHANTNKNEQEGK*
77 >lcl|XP_003310654.1|Plus1complement(7041971..7042942) NW_003456991 mortality factor 4-like protein 1-like LOC461609 __SEG__ Chr4 {Pan troglodytes} MVPKQDPKPKFQEGERVLCFHGPLLYDAKCVKLAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRWAAPGKKTSGLQQKNIEAKT
KKNKQKTPGNGDGGSTSETPQPPQKKRAQVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPADKNVDSILEDYANYKKSHGNTDNKEYAVNEVVAG
IKEYFNLMLGTQLLYKFERPQYAEILADCPDAPMSQVYGVPHLLRLSVQIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVALPEYHWKAV*
78 >lcl|XP_003310693.1|Plus119281..19832 NW_003457014 putative TAF11-like protein ENSP00000332601-like LOC100610600 __SEG__ Chr5 {Pan troglodytes} MPRGLKGSNKDGIPEELDGNLEEPRDEESELRSQDVMDLTEGDNEGSASAPPAPKRQKTDTKEKKERKPTMDAEEAQRITTLLSAMSEEQLSCYEVCRRSAFPKARIAAL
MQSITGRSVSENTAIAMAGIAKVFVGEVVEEALDVCEMWGEMAPLQPKHLREAVHRLKPKGLLPNSNYKKIMF*
79 >lcl|XP_003310694.1|Plus126246..26797 NW_003457014 putative TAF11-like protein ENSP00000332601-like LOC100610690 __SEG__ Chr5 {Pan troglodytes} MPQGLKGSNNDGIPEELDGNLEEPRDQESELRSQDVMDLTEGDNEASASAPPAAKRQKTDTKEKKERKPTVDAEEAQRMTALLSAMSEEQLARYEVCRRSAFPRARIAGL
MQSISGRSVSENTAIAMAGIAKVFVGEVVEEALDVCEMWGETPPLQPKHLREAVRRLKPKGLFPNSNYKKIMF*
80 >lcl|XP_003310746.1|Plus1438877..439668 NW_003457033 transcription initiation factor TFIID subunit 9-like LOC100612178 __SEG__ Chr5 {Pan troglodytes} MESGKMASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPY
SGPRLPPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIG
SKNILITTNMVSSQNTANESSNALKRKREDDDDDDDDDDYDNL*
81 >lcl|XP_003310877.1|Plus1complement(21898995..21899708) NW_003457058 neurogenin-1 NEUROG1 __SEG__ Chr5 {Pan troglodytes} MPAPLETRISDLDCASSSGSDLSGFLTDEEDCARLQQAASASGPPAPARRGAPNISRASEVPGAQDDEQERRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNA
ALDALRSVLPSFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPASDAESWGSGAAAASPLSDPSSPAASEDFTYRPGDPVFSFP
SLPKDLLHTTPCFIPYH*
82 >lcl|XP_003310988.1|Plus1complement(1392134..1392835) NW_003457061 mediator of RNA polymerase II transcription subunit 7 MED7 __SEG__ Chr5 {Pan troglodytes} MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLE
DLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDA
ALCVLIDEMNERP*
83 >lcl|XP_003311051.1|Plus1complement(1229631..1232462) NW_003457082 zinc finger protein 62 homolog isoform 3 ZFP62 __SEG__ Chr5 {Pan troglodytes} MVPITQYVVSKCLSSECCSLLFQFVFVFFFKRVNRCPFHFLGLVSHLKTSTEDEEPTEEYENVGNAASKWPKVEDPMPESKVGDTCVWDSKVENQQKEPVENRMKEDKSS
IREAISKAKSTANIKTEQEGEASEKSLHLSPQHITHQTMPIGQRGSEQGKRVENINGTSYPSLQQKTNAVKKSHKCDECGKSFKYNSRLVQHKIMHTGEKRYECDDCGGT
FRSSSSLRVHKRIHTGEKPYKCEECGKAYMSYSSLINHKSTHSGEKNCKCDECGKSFNYSSVLDQHKRIHTGEKPYECGECGKAFRNSSGLRVHKRIHTGEKPYECDICG
KTFSNSSGLRVHKRIHTGEKPYECDECGKAFITCRTLLNHKSIHFGDKPYKCDECEKSFNYSSLLIQHKVIHTGEKPYECDECGKAFRNSSGLIVHKRIHTGEKPYKCDV
CGKAFSYSSGLAVHKSIHPGKKAHECKECGKSFSYNSLLLQHRTIHTGERPYVCDVCGKTFRNNAGLKVHRRLHTGEKPYKCDVCGKAYISRSSLKNHKGIHLGEKPYKC
SYCEKSFNYSSALEQHKRIHTREKPFGCDECGKAFRNNSGLKVHKRIHTGERPYKCEECGKAYISLSSLINHKSVHPGEKPFKCDECEKAFITYRTLINHKKVHLGEKPY
KCDVCEKSFNYTSLLSQHRRVHTREKPYECDRCEKVFRNNSSLKVHKRIHTGERPYECDVCGKAYISHSSLINHKSTHPGKTPHTCDECGKAFFSSRTLISHKRVHLGEK
PFKCVECGKSFSYSSLLSQHKRIHTGEKPYVCDRCGKAFRNSSGLTVHKRIHTGEKPYECDECGKAYISHSSLINHKSVHQGKQPYNCECGKSFNYRSVLDQHKRIHTGK
KPYRCNECGKAFNIRSNLTKHKRTHTGEESLNVIYVGSYSGTSQKRTYEGGNALDGGRMRMPL*
84 >lcl|XP_003311052.1|Plus1complement(1229631..1231715) NW_003457082 zinc finger protein 62 homolog isoform 4 ZFP62 __SEG__ Chr5 {Pan troglodytes} MSYSSLINHKSTHSGEKNCKCDECGKSFNYSSVLDQHKRIHTGEKPYECGECGKAFRNSSGLRVHKRIHTGEKPYECDICGKTFSNSSGLRVHKRIHTGEKPYECDECGK
AFITCRTLLNHKSIHFGDKPYKCDECEKSFNYSSLLIQHKVIHTGEKPYECDECGKAFRNSSGLIVHKRIHTGEKPYKCDVCGKAFSYSSGLAVHKSIHPGKKAHECKEC
GKSFSYNSLLLQHRTIHTGERPYVCDVCGKTFRNNAGLKVHRRLHTGEKPYKCDVCGKAYISRSSLKNHKGIHLGEKPYKCSYCEKSFNYSSALEQHKRIHTREKPFGCD
ECGKAFRNNSGLKVHKRIHTGERPYKCEECGKAYISLSSLINHKSVHPGEKPFKCDECEKAFITYRTLINHKKVHLGEKPYKCDVCEKSFNYTSLLSQHRRVHTREKPYE
CDRCEKVFRNNSSLKVHKRIHTGERPYECDVCGKAYISHSSLINHKSTHPGKTPHTCDECGKAFFSSRTLISHKRVHLGEKPFKCVECGKSFSYSSLLSQHKRIHTGEKP
YVCDRCGKAFRNSSGLTVHKRIHTGEKPYECDECGKAYISHSSLINHKSVHQGKQPYNCECGKSFNYRSVLDQHKRIHTGKKPYRCNECGKAFNIRSNLTKHKRTHTGEE
SLNVIYVGSYSGTSQKRTYEGGNALDGGRMRMPL*
85 >lcl|XP_003311058.1|Plus138662..39213 NW_003457082 high mobility group protein B3-like LOC471771 __SEG__ Chr5 {Pan troglodytes} MAKGDPKKPKGKMSAYVFFVQTCREECKKKNPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKTDKVHRDREMKGPAKGGKKKKDPSAPKRPPSGFFLFSSEIRPKIKSTN
PGISVGDVAKKLGEMWNNLNDSEKQPYITKAAKLKEKYEKDVADSKSKGKFDGSKRPAKVAWKKVEEKMKTRR*
86 >lcl|XP_003311125.1|Plus1complement(23124567..23125775) NW_003457102 zinc finger protein 322A isoform 1 ZNF322A __SEG__ Chr6 {Pan troglodytes} MYTSEEKCNQRTQKRKIYNVCPRKGKKIFIHVHEIIQIDGHIYQCLECKQNFCENLALIMCERTHTGEKPYKCDMCEKTFVQSSDLTSHQRIHNYEKPYKCSKCEKSFWH
HLALSGHQRTHAGKKFYTCDICGKNFGQSSDLLVHQRSHTGEKPYLCSECDKCFSRSTNLIRHRRTHTGEKPFKCLECEKAFSGKSDLISHQRTHTGERPYKCNKCEKSY
RHRSAFIVHKRVHTGEKPYKCGACEKCFGQKSDLIVHQRVHTGEKPYKCLECMRSFTRSANLIRHQATHTHTFKCLEYEKSFNCSSDLIVHQRIHMEEKPHQWSACESGF
LLGMDFVAQQKMRTQTEELHYKYTVCDKSFHQSSALLQHQTVHIGEKPFVCNVSEKGLELSPPHASEASQMS*
87 >lcl|XP_003311170.1|Plus1complement(1352375..1353004) NW_003457108 zinc finger protein 323 isoform 5 ZNF323 __SEG__ Chr6 {Pan troglodytes} MEHLGDSRLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKECGKAFSAS
NGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQKIHTGERL*
88 >lcl|XP_003311184.1|Plus11177622..1178431 NW_003457108 zinc finger protein 192-like LOC100610147 __SEG__ Chr6 {Pan troglodytes} MDPHQKVPSIYNGDTLQTPEYEKVSLYEDQLERHESRHMEERRYKCNECGKKFAQSSGLVRHQRIHTGEKPYECDHCGKAFSVRSTLTVHERIHTGEKPYTCNECKKAFS
VRAHLILHQRIHNGEKPYECNECGKAFSVSSDLIKHQRIHTGEKPYECDECGKAFSVSSALIKHQRIHTGEKPYECKECGKAFYVNSALTNHQRIHSGEKPYECGECGKA
FSQISTLIHHQRIHTGEKPYECEECGKAFRGSSNLTKHQKTHAKGKCHQ*
89 >lcl|XP_003311573.1|Plus1complement(38381825..38383060) NW_003457154 zinc finger protein PLAGL1 PLAGL1 __SEG__ Chr6 {Pan troglodytes} MATHSPQKSHQCAHCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDLTCGVCALELGSTEVLLDHLKAHAEEKPPSGTKEKKHQCDHCE
RCFYTRKDVRRHLVVHTGCKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQVA
QPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPESPQKLNPGFDLAKGNAGKVNLPKELPADAVNLTIPASLDLSP
LLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQQQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR*
90 >lcl|XP_003311687.1|Plus1complement(914179..915180) NW_003457216 early growth response protein 3 EGR3 __SEG__ Chr8 {Pan troglodytes} MDIGLTNEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQ
GNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERP
HACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVT
TCA*
91 >lcl|XP_003311759.1|Plus1complement(496870..497679) NW_003457224 CCAAT/enhancer-binding protein delta CEBPD __SEG__ Chr8 {Pan troglodytes} MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLG
PGPAAPRPLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSSGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQ
QKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR*
92 >lcl|XP_003311864.1|Plus1complement(6424382..6425638) NW_003457226 zinc finger protein PLAG1 PLAG1 __SEG__ Chr8 {Pan troglodytes} MATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKETFKCEECGKNYNTKLGFKRHLALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSSGGVKEKKHQCEHCDR
RFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQELLKVKTEPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQSSG
SAHQMITTLPLGMTCPIDMDTVHPSHHLSFKYPFSSTSYAISIPEKEQPLKGEIESYLMELQGGVPSSSQDSQASSSSKLGLDPQIGSLDDGAGDLSLSKSSISISDPLN
TPALDFSQLFNFIPLNGPPYNPLSVGSLGMSYSQEEAHSSVSQLPPQTQDLQDPANTIGLGSLHSLSAAFTSSLSTSTTLPRFHQAFQ*
93 >lcl|XP_003311998.1|Plus1291150..291746 NW_003457272 zinc finger protein 41 homolog LOC472882 __SEG__ Chr8 {Pan troglodytes} MEKPAGRKKKTPTPREEADVQKSALREEKVSGDRKPPERPTVPRKPRTEPCLSPEDEEHVFDAFDASFKDDFEGVPVFIPFQRKKPYECSECGRIFKHKTDHIRHQRVHT
GEKPFKCAQCGKAFRHSSDVTKHQRTHTGEKPFKCGECGKAFNCGSNLLKHQKTHTGEKPYECTDCGKAFAYSSCLIRHQKRHPRKKP*
94 >lcl|XP_003312005.1|Plus1702743..704353 NW_003457272 zinc finger protein 623 ZNF623 __SEG__ Chr8 {Pan troglodytes} MILLSFVSDSNVGTGEKEVTEAWISEDENSRRTTSDRLTVMELPSPESEEVHEPRLGELLGNPEGQSLGSSPSQDRGCKQVTVTHWKIQTGETAQVCTKSGRNRILNSDL
LLLQRELIEGEANPCDICGKTFTFNSDLVRHRISHAGEKPYTCDQCGKGFGQSSHLMEHQRIHTGERLYVCNVCGKDFIHYSGLIEHQRVHSGEKPFKCAQCGKAFCHSS
DLIRHQRVHTRERPFECKECGKGFSQSSLLIRHQRIHTGERPYECNECGKSFIRSSSLIRHYQIHTEVKQYECKECGKAFRHRSDLIEHQRIHTGERPFECNECGKAFIR
SSKLIQHQRIHTGERPYVCNECGKRFSQTSNFTQHQRIHTGEKLYECNECGKAFFLSSYLIRHQKIHTGERVYECKECGKAFLQKAHLTEHQKIHSGDRPFECKDCGKAF
IQSSKLLLHQIIHTGEKPYVCSYCGKGFIQRSNFLQHQKIHTEEKLYECSQYGRDFNSTTNFKNNQSVHQEGLSLSKAPIHLGERSVDKGEHTGNL*
95 >lcl|XP_003312006.1|Plus1702863..704353 NW_003457272 zinc finger protein 623 ZNF623 __SEG__ Chr8 {Pan troglodytes} MELPSPESEEVHEPRLGELLGNPEGQSLGSSPSQDRGCKQVTVTHWKIQTGETAQVCTKSGRNRILNSDLLLLQRELIEGEANPCDICGKTFTFNSDLVRHRISHAGEKP
YTCDQCGKGFGQSSHLMEHQRIHTGERLYVCNVCGKDFIHYSGLIEHQRVHSGEKPFKCAQCGKAFCHSSDLIRHQRVHTRERPFECKECGKGFSQSSLLIRHQRIHTGE
RPYECNECGKSFIRSSSLIRHYQIHTEVKQYECKECGKAFRHRSDLIEHQRIHTGERPFECNECGKAFIRSSKLIQHQRIHTGERPYVCNECGKRFSQTSNFTQHQRIHT
GEKLYECNECGKAFFLSSYLIRHQKIHTGERVYECKECGKAFLQKAHLTEHQKIHSGDRPFECKDCGKAFIQSSKLLLHQIIHTGEKPYVCSYCGKGFIQRSNFLQHQKI
HTEEKLYECSQYGRDFNSTTNFKNNQSVHQEGLSLSKAPIHLGERSVDKGEHTGNL*
96 >lcl|XP_003312018.1|Plus11908196..1909968 NW_003457272 zinc finger protein 7 isoform 3 ZNF7 __SEG__ Chr8 {Pan troglodytes} MDILESESYGTVVRISPQDFPQNPGFGDVSDSEVWLDSHLGSPGLKVTGFTFQNNCLNEETVVPKTFTKDAAQGCKELGSSGLDCQPLESQRESAEGMSQRCEECGKGIR
ATSDIALHWEINTQKISRCQECQKKLSDCLQGKHPNNCHGEKPYECAECGKVFRLCSQLNQHQRIHTGEKPFKCTECGKAFRLSSKLIQHQRIHTGEKPYRCEECGKAFG
QSSSLIHHQRIHTGERPYGCHECGKAFSQQSQLVRHQRTHTGERPYPCKECGKAFSQSSTLAQHQRMHTGEKAQILKASDSPSLVAHQRIHAVEKPFKCDECGKAFRWIS
RLSQHQLIHTGEKPYKCNKCTKAFGCSSRLIRHQRTHTGEKPFKCDECGKGFVQGSHLIQHQRIHTGEKPYVCNDCGKAFSQSSSLIYHQRIHKGEKPYECLQCGKAFSM
STQLTIHQRVHTGERPYKCNECGKAFSQNSTLFQHQIIHAGVKPYECSECGKAFSRSSYLIEHQRIHTRAQWFYEYGNALEGSTFVSRKKVNTIKKLHQCEDCEKIFRWR
SHLIIHQRIHTGEKPYKCNDCGKAFNRSSRLTQHQKIHTG*
97 >lcl|XP_003312079.1|Plus1complement(32224667..32230141) NW_003457279 LOW QUALITY PROTEIN: TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 210kDa-like TAF1L __SEG__ Chr9 {Pan troglodytes} MGPGCDLLLRAAATVTAAIMSDSDSEEDSSGGGPFTLAGILFGNISGTGQLEGESVLDDECKKHLAGLGALGLGNLITELTANEELTGTGGALVNDEGWIRSTEDAVDYS
DINEVAEDESRRHQQTMGSLQPLYHSDYEDDYDADCEDIDCKLMPPPPPPPGPMKKDKDQDAITCVSESGEDIILPSIIAPSFLASEKVDFSSYSDSESEMGPQEATQAE
SEDGKLTLPLAGIMQHDATKLLPSVTELFPEFRPGKVLRFLHLFGPGKNVPSVWRSARRKRKKHRELIQEEQIQEVECSVESEVSQKSLWNYDYAPPPPPEQCLADDEIT
MMVPVESKFSQSTGDVDKVTDTKPRVAEWRYGPARLWYDMLGVSEDGSGFDYGFKLRKTQHEPVIKSRMMEEFRKLEESNGTDLLADENFLMVTQLHWEDSIIWDGEDVK
HKGTKPQGASLAGWLPSIKTRNVMAYNVQQGFAPTLDDDKPWYSIFPIDNEDLVYGRWEDNIIWDAQAMPRLLEPPVLALDPNDENLILEIPDEKEEATSNSPSKESKKE
SSLKKSRILLGKTGVIREEPQQNMSQPEVKDPWNLSNDEYYFPKQQGLRGTFGGNIIQHSIPAMELWQPFFPTHMGPIKIRQFHRPPLKKYSFGALSQPGPHSVQPLLKH
IKKKAKMRERERQASGGGELFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYGETVYCHTSPFLGSLHPGQLLQALENNLFRAPV
YLHKMPETDFLIIRTRQGYYIRELVDIFVVGQQCPLFEVPGPNSRRANMHIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSHSESSIRKRLKLCADFNRTGMDSNWW
VLKSDFRLPTEEEIRAKVSPEQCCAYYSMIAAKQRLKDAGYGEKSFFAPEEENEEDFQMKIDDEVHAAPWNTTRAFIAAMKGKCLLEVTGVADPTGCGEGFSYVKIPNKP
TQQKDDKEPQAVKKTVTGTDADLRRLSLKNAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQAHSGEGPMSKFARGSRFSVAEHQEHYKEECQRIFDLQNKVLSSTEV
LSTDTDSSSAEDSDFEEMGKNIENMLQNKKTSSQLSHEWEEQERKELRRMLLVAGSAASGNNHRDDDTASMTSLNSSATGHCLKIYRTFRDEEGKEYVRCETVRKPAVID
AYVRIRTTKDEKFIQKFALFDEKHREEMRKERRRIQEQLRRLKRSQEKEKLKGPPEKKPKKVKERPDLKLKCGACGAIGHMRTNKFCPLYYQTNVPPSKPVAMTEEQEEE
LEKTVIHNDNEELIKVEGTKIVLGKQLIENVDEVRRKSLVLKFPKQQLPPKKKRRVGTTVHCDYLNIPHKSIHRRRTDPMVTLSSILESIVNDMRDLPNTHPFHTPVNAK
FVKDYYKIITRPMDLQTLRENVRKCLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLDDDDQVAFSFFWTTLSPRK*WQF
QILGHFITQLIRSLFQIITK*LSIQWI*RPYVRTSPSTSIRVGRVF*MM*TLFLPTVLSIMDLRVSTLRLLRRL*TSVTRQLLSMMSI*LNLRRIFVQLKKQLWRKQN*K
AWTQ*PQGPTHLGLLICMIPTHPSVRLEMPLYFKMRAICLSWIFPLPLQKSRCARAKVGWVRKTLMWMLKGMMMRRRMGNLSLQPQKGEMVILQMKRKELYNNLKPVSCM
RICLYLKEKMMRKMLGVMKKETILSLLSS*VKVEVTLMWDMVE*DPNNPSCFSMLQENTRMGMEN
98 >lcl|XP_003312157.1|Plus18686..9939 NW_003457450 forkhead box protein D4-like 3-like LOC100613179 __SEG__ Chr9 {Pan troglodytes} MNLPRAERLRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQQFLEQSLQPGLQVARWGGVALPREHIEGGGGPSDPSEFGTKFRAPPRSAAASEDARQPAKPP
YSYIALITMAILQNPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIHHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLRRRKRFKRHQLTPGAHLPHPFP
LPAAPAALHNPRPGPLLGAPAPPQPVPGAYPNTAPGRRPYALLHPHPLRYLLLSAPVYAGAPKKAEGADLATPAPFPCCSPHLVLSLGRRARVWRRHREADASLSALRVL
CKGSGERVQGLRRVCPRPRGATATCSSDHQACCIPKPLPLCCKCPPPPLLGQFCSNSSSIRRRTAPTAALPPRARCWAGTCRPRRRC*
99 >lcl|XP_003312265.1|Plus1complement(7853326..7854384) NW_003457475 zinc finger protein 883 isoform 1 ZNF883 __SEG__ Chr9 {Pan troglodytes} MESEKIYMTANPYLCTECGKGYTCIASLTQHQKTHIGEKPYECKICGKSFTRNTNLIQHQRIHTGEKPYECNECGKAFSQSTNLIQHQRVHTGEKPYECNECEKTFSHRS
SLRNHERIHTGEKPYPCNECGKAFSHISALTQHHRIHTGKKPYECTECGKTFSRSTHLIEHQGIHSEEKSYQCKECRKVFCHSTSLIRHQRTHTGEKPYECNECGKAFSH
TPAFIQHQRIHTGEKPYECYACGKAFNRSAHLTEHQRTHTGEKPYVCKECGKTFSRSTHFTEHLKIHSGVKPYRCNECQKLFCYRTSLIRHQRMHTGEKPYQCNECGKSF
SLSSALTKHKQIHNKGETLSMY*
100 >lcl|XP_003312511.1|Plus1638855..639202 NW_003457524 transcription elongation factor B polypeptide 1-like LOC735372 __SEG__ Chr10 {Pan troglodytes} MDGEEKTCGGCEGPDAMYVKLISSDGHEFIAKREHALTSGTIKTTLGGPGQSAVNETNEVNFREIPSRVLSKVCMYFMYKVRYPNSSTEVPELPIAPEIALELLMDVSFL
DWEIK*
101 >lcl|XP_003312594.1|Plus1complement(1309471..1310841) NW_003457543 zinc finger protein 239 isoform 1 ZNF239 __SEG__ Chr10 {Pan troglodytes} MASTITGSQDCIVNHRGEVDGEPELDISPCQQWGEASSPISRNRDSVMTLQSDCLENIESETYLPLKVSSQIDTQDSSVKFCKNEPQDHQESRRLFVMEESTERKVIKGE
SCSQNLQVKLVSDGQELASPLLNGEATCQNGQLKESLDPIDCNFKDIHGWKSQVVSCSQQRAHTEEKPCDHNNCGKILNTDGHPYEKIHTAEKQYECSQCGKNFSQSSEL
LLHQRDHTEEKPYKCEQCGKGFTRSSSLLIHQAVHTDEKPYKCDKCGKGFTRSSSLLIHHAVHTGEKPYKCDKCGKGFSQSSKLHIHQRVHTGEKPYECEECGMSFSQRS
NLHIHQRVHTGERPYKCGECGKGFSQSSNLHIHRCIHTGEKPYQCYECGKGFSQSSDLRIHLRVHTGEKPYHCGKCGKGFSQSSKLLIHQRVHTGEKPYECSKCGKGFSQ
SSNLHIHQRVHKKDPR*
102 >lcl|XP_003313555.1|Plus13820012..3820365 NW_003457719 prothymosin alpha-like LOC465443 __SEG__ Chr12 {Pan troglodytes} MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNANEENGEPEADNEVDEEEEEGGEEEEEEGDGEEEDGDEDEGAESATGKRAAEDDEDDDVDTKKQKTDEDDQT
AKKEKLN*
103 >lcl|XP_003313953.1|Plus1complement(17087287..17088444) NW_003457733 mTERF domain-containing protein 3, mitochondrial MTERFD3 __SEG__ Chr12 {Pan troglodytes} MLWKLLLRSQSCRLCSFRKMRSPPKYRPFLACFTYTTDRQSSKENIRTVEKLYKCSVDIRKIRRLKGWVLLEDETYVEEIANILQELGADETAVASILERCPEAIVCSPT
AVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQELGLKNVVISRLLTAAPNVFHNPVEKNKQMVRILQESYLDVGGSEANMKVWLLKLLSQNPFIL
LNSPTAIKETLEFLQEQGFTSFEILQLLSKLKGFLFQLCPRSIQNSISFSKNAFKCTDHDLKQLVLKCPSLLYYSVPVLEERMQGLLREGISIAQIRETPMVLELTPQIV
QYRIRKLNSLGYRIKDGHLANLNGSKKEFEANFGKIQAKKVRPLFNPVAPLNVEE*
104 >lcl|XP_003314095.1|Plus1complement(373905..375539) NW_003457781 zinc finger protein 891-like LOC100610530 __SEG__ Chr12 {Pan troglodytes} MAVMDLSSPWALTKQDSACFHLRNAEEERMIAVFLTTWLQEPMTFKDVAVEFTQEEWMMLDSAQRSLYRDVMLENYRNLTSVEYQLYRLTVISPLDQEEIRNMKKRIPQA
ICPDQKIQPKTKESTVQKILWEEPSNAVKMIKLTMHNWSSTLREDWECHKIRKQHKIPGGHWRQMTYAPNKTVSQELFRDYHELEENSKLRSKLIFSQSIFTSKHCQKCY
SEIGCLKHNSIINNYVKNSISEKLYESHECDTTLWHLQRNQTVQKEYTYSKHGMHFTHNMFPVPNNLHMAQNACECNKDETLCHQSSLKKQGQTHTEKKHECNQCGKAFK
RISNLTLYKKSHMGEKQYECKECGKVFNDSSTLRRHVRTHTGEKPYECNQCGKAFSQKTSLKAHMRTHTGEKPYECNQCGKSFGTSSYLIVHKRIHTGEKLYECSECGKA
FNTSSHLKVHKKIHTGENLYECSDCGKVFSGVSSLRMHIRTHTGEKPYECKECRKAFSVSSSLRRHVRIHTGEKPYECIQCGKAFSQSSSLIIHKRIHTERETL*
105 >lcl|XP_003314188.1|Plus1complement(1692554..1692730) NW_003457804 DNA-directed RNA polymerases I, II, and III subunit RPABC4-like LOC100608472 __SEG__ Chr13 {Pan troglodytes} MDTRKDIQTPKQQPMAYNCRECHTENDMKSRDPVKCGECGYRIIYKKRTERLVGFDAQ*
106 >lcl|XP_003314723.1|Plus17655253..7655900 NW_003457950 elongation factor 1-beta-like LOC100609807 __SEG__ Chr15 {Pan troglodytes} MGFGDLKSPAGLQVLNDYLTDKSYIKGYVPSQADVAVFEAVPRPLPADLCHALCWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLSGSDDEE
ESEEAKRLREERLAQYESKKAKKPALVKSWDDETDMAKLEGIRSIQADVLVWDSSKLVPVGYRIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI*
107 >lcl|XP_003314891.1|Plus1121917..123377 NW_003457960 zinc finger and SCAN domain-containing protein 2-like LOC100610406 __SEG__ Chr15 {Pan troglodytes} MFFFIVSDFEIQSENGENCNQDMFENESHKIFSEMPEGESAQHSDGESDFERDAGIQRPQGHTPGEDHGEVVSQDREVGQLIGLQGTYLGEKPYECPQCGKTFSRKSHLI
THERTHTGEKYYKCDECGKSFSDGSNFSRHQTTHTGEKPYKCRDCGKSFSRSANLITHQRIHTGEKPFQCAECGKSFSRSPNLIAHQRTHTGEKPYSCPECGKSFGNRSS
LNTHQGIHTGEKPYECKECGESFSYNSNLIRHQRIHTGEKPYKCTDCGQRFSQSSALITHRRTHTGEKPYQCSECGKSFSRSSNLATHRRTHMVEKPYKCGVCGKSFSQS
SSLIAHQGMHTGEKPYECLTCGESFSWSSNLLKHQRIHTGEKPYKCSECGKCFSQRSQLVVHQRTHTGEKPYKCLMCGKSFSRGSILVMHQRAHLGDKPYRCPECGKGFS
WNSVLIIHQRIHTGEKPYKCPECGKGFSNSSNFITHQRTHMKEKLY*
108 >lcl|XP_003315282.1|Plus1complement(5287873..5288994) NW_003458218 transcription factor Maf MAF __SEG__ Chr16 {Pan troglodytes} MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPMSTPCSSVPPSPSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSP
EDAVEALISNSHQLQGGFDGYARGAQQLAAAAGAGAGASLGGSGEEMGPAAAVVSAVIAAAAAQSGAGPHYHHHHHHAAGHHHHPTAGAPGAAGSAAASAGGAGGAGGGG
PASAGGGGGGGGGGGGGGAAGAGGALHPHHAAGGLHFDDRFSDEQLVTMSVRELNRQLRGVSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHVLESEKNQLLQQVDHL
KQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFM*
109 >lcl|XP_003315377.1|Plus1complement(783227..786589) NW_003458253 zinc finger protein 594 isoform 1 ZNF594 __SEG__ Chr17 {Pan troglodytes} MKEWKSKMEMSEEKKSARAASEKLQRQITQECELVESSNSEDRLLKHWVSPLKDAMRHLPSQESSIREMHIIPQKAIVGEIGHGCNEGEKILSAGESSHRYEVSGQNFKQ
KSGLTEHQKIHNINKTYECKECGKTFNRSSNLIIHQRIHTGNKPYVCNECGKDSNQSSNLIIHQRIHIGKKPYICHECGKDFNQSSNLVRHKQIHSGGNPYECKECGKAF
KGSSNLVLHQRIHSRGKPYLCNKCGKAFSQSTDLIIHHRIHTGEKPYECYDCGQMFSQSSHLVPHQRIHTGEKPLKCNECEKAFRQHSHLTEHQRLHSGEKPYECHKCGK
TFSGRTAFLKHQRLHAGEKLEECEKTFSKDEELREEQRIHQEEKAYWCNQCGRNFQGTSDLIRHQVTHTGEKPYECKECGKTFNQSSDLVRHHRIHSGEKPCVCSKCGKS
FRGSSDLIRHHRVHTGEKPYECSECGKAFSQRSHLVTHQKIHTGEKPYQCTECGKAFRRRSLLIQHRRIHSGEKPYECKECGKLFIWRTAFLKHQSLHTGEKLECEKTFS
QDEELRGEQKIHQEEKAYWCNQCGRAFQGSSDLIRHQVTHTREKPYECKECGKTFNQSSDLLRHHRIHSGEKPYVCNKCGKSFRSSSDLIKHHRIHTGEKPYECSECGKA
FSQRSHLATHQKIHTGEEPYQCSECGNAFRRRSLLIQHRRLHSGEKPYECKECGKLFMWRTAFLKHQRLHAGEKLEECEKTFSKDEELRKEQRTHQEKKVYWCNQCSRTF
QGSSDLIRHQVTHTREKPYECKECGKTFNQSSDLLRHHRIHSGEKPYICNKCGESFRSSSDLIKHHRVHTGEKPHECSECGKVFSQRSHLVTHQKIHTGEKPYQCTECEK
AFRRHSLLIQHRRIHSGEKPYECKECGKLFMWHTAFLKHQRLHAGEKLEECEKTFSKDEELRGEQRTHQEEKAYWCNQCSRNFQGSSDFIGHQVTHTGEKPYECKECGKT
FNQSSDLVRHHRIHSGEKPYVCNKCGKSFRGSSDLIRHHRVHTGEKPYECPECGKAFSQNSHLVSHQRIHTREKPFECSNCGKAFSGWTAFLKHQKLHIGKEFEDCKSLQ
TGPILIGSRNLMNAVKLGKV*
110 >lcl|XP_003316188.1|Plus1944108..945151 NW_003458474 transcription factor jun-B isoform 1 JUNB __SEG__ Chr19 {Pan troglodytes} MCTKMEQPFYHDDSYTTTGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYF
YPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAP
PFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMT
HVSNGCQLLLGVKGHAF*
111 >lcl|XP_003316279.1|Plus1complement(2637318..2638781) NW_003458492 zinc finger protein 708 ZNF708 __SEG__ Chr19 {Pan troglodytes} MCSHFAKDLRPEQYIKNSFQQAILRRYGKCGYQKGCKSVDEHKLHKGGHKGLNRCVTTTQSKIVQYDKYVKVFHKYSNTKRHKIRHTGKNPFICKECGKSFCMLSQLTQH
EIIHTGEKPYKCEECGKAFKKSSNLTNHKIIHTGEKPYKCEECGKAFNQSSTLTRHKIIHTGEKLYKCEECGKAFNRSSNLTKHKIVHTGEKPYKCEECGKAFKQSSNLT
NHKKIHTGEKPYKCGECGKAFTLSSHLTTHKRIHTGEKPYKCEECGKAFSVFSTLTKHRIIHTEEKPYKCEECGKAFNRSSHLTNHKVIHTGEKPYKCEECGKAFTKSST
LTYHKVIHTGKKPYKCEECGKAFSIFSILTKHKVIHTEEKPYKCEECGKTFNYSSNFTNHKKIHTGEKPYKCEECGKSFILSSHLTTHKIIHTGEKPYKCKECGKAFNQS
STLMKHKIIHTGEKPYKCEECGKAFNQSPNLTKHKRIHTKEKPYKCK*
112 >lcl|XP_003316304.1|Plus16338146..6338598 NW_003458495 CCAAT/enhancer-binding protein gamma-like LOC100612381 __SEG__ Chr19 {Pan troglodytes} MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKL
LTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDSAGQ*
113 >lcl|XP_003316336.1|Plus1584400..585278 NW_003458502 zinc finger protein OZF ZNF146 __SEG__ Chr19 {Pan troglodytes} MSHLSQQRIYSGENPFACKVCGKVFSHKSNLTEHEHFHTREKPFECNECGKAFSQKQYVIKHQNTHTGEKLFECNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKAFI
QKSNLIRHQRTHTGEKPFVCKECGKTFSGKSNLTEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTGEKPYECNECGKAFSQRTSLIVHVRIHSGDKPYECNVCGKA
FSQSSSLTVHVRSHTGEKPYGCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQKSHHIRHQKIHTH*
114 >lcl|XP_003316345.1|Plus1complement(1010738..1012204) NW_003458502 zinc finger protein 345 ZNF345 __SEG__ Chr19 {Pan troglodytes} MENLTKHSIECSSFRGDWECKSQFERKQGSQEGHFSEMVFTPEDMPTFSIQHQRIHTDEKLLECKECGKDFSFVSVLVRHQRIHTGEKPYECKECGKAFGSGANLAYHQR
IHTGEKPFECKECGKAFGSGSNLTHHQRIHTGEKPYECKECGKAFSFGSGLIRHQIIHSGEKPYECKECGKSFSFESALIRHHRIHTGEKPYECIDCGKAFGSGSNLTQH
RRIHTGEKPYECKACGMAFSSGSALTRHQRIHTGEKPYICNECGKAFSFGSALTRHQRIHTGEKPYVCKECGKAFNSGSDLTQHQRIHTGEKPYECKECEKAFRSGSKLI
QHQRMHTGEKPYECKECGKTFSSGSDLTQHHRIHTGEKPYECKECGKAFGSGSKLIQHQLIHTGERPYECKECGKSFSSGSALNRHQRIHTGEKPYECKECGKAFYSGSS
LTQHQRIHTGEKPYECKNCGKAYGRDSEFQQHKKSHNGKKLCELETIN*
115 >lcl|XP_003316387.1|Plus1complement(1694910..1696493) NW_003458502 zinc finger protein 569 ZNF569 __SEG__ Chr19 {Pan troglodytes} MRKEHCEYNEPVKSYGNSSSHFVITPFKCNHCGKGFNQTLDLIRHLRIHTGEKPYECSNCRKAFSHKEKLIKHYKIHSREQSYKCNECGKAFIKMSNLIRHQRIHTGEKP
YACKECEKSFSQKSNLIDHEKIHTGEKPYECNECGKAFSQKQSLIAHQKVHTGEKPYACNECGKAFPRIASLALHMRSHTGEKPYKCDKCGKAFSQFSMLIIHVRIHTGE
KPYECNECGKAFSQSSALTVHMRSHTGEKPYECKECRKAFSHKKNFITHQKIHTREKPYECNECGKAFIQMSNLVRHQRIHTGEKPYICKECGKAFSQKSNLIAHEKIHS
GEKPYECNECGKAFSQKQNFITHQKVHTGEKPYDCNECGKAFSQIASLTLHLRSHTGEKPYECDKCGKAFSQCSLLNLHMRSHTGEKPYVCNECGKAFSQRTSLIVHMRG
HTGEKPYECNKCGKAFSQSSSLTIHIRGHTGEKPFDCSKCGKAFSQISSLTLHMRKHTGEKPYHCIECGKAFSQKSHLVRHQRIHTH*
116 >lcl|XP_003316655.1|Plus1complement(2022719..2024185) NW_003458524 zinc finger protein 816-like isoform 3 ZNF91 __SEG__ Chr19 {Pan troglodytes} MLGRKDDAQKQPVKNPLGLNLQSHLPELQLSQAEGKIDKYDHMEKSLNSSSLVSPPQRISSTVKTHISHTCECNFVDSLFTQKEKANIGTEHYKCNERGKAFHQGLHFTI
HQIIHTKETQFKCDICGKIFNKKSNLASHQRIHTGEKPYKCNECGKVFHNMSHLAQHRRIHTGEKPYKCNECGKVFNQLSHLAQHQRIHTGEKPYKCNECGKVFHQISHL
AQHRTIHTGEKPYECNKCGKVFSRNSYLVQHLIIHTGEKPYRCNVCGKVFHHISHLAQHQRIHTGEKPYKCNECGKVFSHKSSLVNHRRIHTGEKPYKCNECGKVFSRHS
YLAQHLIIHTGEKPYKCDECDKAFSQNSHLVQHRRIHTGEKPYKCDECGKVFSQNSYLAYHWRIHTGEKPYKCNECGKVFSLNSSLAHHRKIHTGEKPYKCNECGKAFSM
RSSLTNHHSIHTGEKHFKCNECGKLFRNNSYLVRHQRFHAGKKSNKCN*
117 >lcl|XP_003316656.1|Plus1complement(2022719..2024341) NW_003458524 zinc finger protein 816-like isoform 4 ZNF91 __SEG__ Chr19 {Pan troglodytes} MLERHESHDIQDFCFRETQKNVHDSQCLWQHDERHYKRVCVTCKESLIGRRDMLGRKDDAQKQPVKNPLGLNLQSHLPELQLSQAEGKIDKYDHMEKSLNSSSLVSPPQR
ISSTVKTHISHTCECNFVDSLFTQKEKANIGTEHYKCNERGKAFHQGLHFTIHQIIHTKETQFKCDICGKIFNKKSNLASHQRIHTGEKPYKCNECGKVFHNMSHLAQHR
RIHTGEKPYKCNECGKVFNQLSHLAQHQRIHTGEKPYKCNECGKVFHQISHLAQHRTIHTGEKPYECNKCGKVFSRNSYLVQHLIIHTGEKPYRCNVCGKVFHHISHLAQ
HQRIHTGEKPYKCNECGKVFSHKSSLVNHRRIHTGEKPYKCNECGKVFSRHSYLAQHLIIHTGEKPYKCDECDKAFSQNSHLVQHRRIHTGEKPYKCDECGKVFSQNSYL
AYHWRIHTGEKPYKCNECGKVFSLNSSLAHHRKIHTGEKPYKCNECGKAFSMRSSLTNHHSIHTGEKHFKCNECGKLFRNNSYLVRHQRFHAGKKSNKCN*
118 >lcl|XP_003316673.1|Plus1complement(2196696..2198693) NW_003458524 zinc finger protein 28 isoform 2 ZNF28 __SEG__ Chr19 {Pan troglodytes} MMKTFFSTGQGNTEVIHTGTLQRQASHHTGDFCFQKIEKDIHGFQFQWKEDETNDHAAPMTEIKELTGSTGRHDQRHAGNKPIKDQLGSSFHSHLPELHIFQSEGKIGNQ
VEKSINNASSVSTAQRISCRPKTHISNKYGNNSLHSSLLTQKRNVHMREKSFQCIESGKSFNCSSLLKKHQITHLEEKQCKCDVYGKVFNQKRYLACHRRSHIDEKPYKC
NECGKIFGHNTSLFLHKALHTADKLYECEECDKVFSRKSHLETHKIIYTGGKPYKCRVCDKAFTCNSYLAKHTIIHTGEKPYKCNECGKVFNRLSTLARHRRLHTGEKPY
ECEECEKVFSRKSHLERHKRIHTGEKPYKCKVCDKAFAYNSYLAKHSIIHTGEKPYKCNECGKVFNQQSTLARHHRLHTAEKPYKCEECDKVFRCKSHLERHRRIHTGEK
PYKCKVCDKAFRSDSCLTEHQRVHTGEKPYTCNECGKVFSTKANLACHHKLHTAEKPYKCEECEKVFSRKSHMERHRRIHTGEKPYKCKVCDKAFRRDSHLAQHQRVHTG
EKPYKCNECGKTFRQTSSLIIHRRLHTGEKPYKCNECGKAFSQMSSLVYHHRLHSGEKPYKCNECGKVFNQQAHLAQHQRVHTGEKPYKCNECGKTFSQMSNLVYHHRLH
SGEKP*
119 >lcl|XP_003316677.1|Plus1complement(2237181..2238590) NW_003458524 zinc finger protein 468 isoform 2 ZNF468 __SEG__ Chr19 {Pan troglodytes} MLKTLSSTGQGNTEVIHTGTLHRQASHHTGEFCFHEIEKDIRGFEFQWKEDETNDHAAPMTEIKELAGSTGQHDQSHAGHKPIKDQLGSSFHSHLPEPHIFQSEGKIGNQ
VEKSINNASSVSTSQRISCRPKTHISNKYGNNSLLSSLLTQKWEVHMREKSFECIQSFKSFNCSSLLKKHQIIHLEEKQCKCDVCGKVFNQKRYLACHRRCHTGEKPYKC
NECGKTFGHNSSLFIHKALHTGEKPYECEECDKVFSRKSHLERHKRIHTGEKPYKCKVCDEAFAYNSYLAKHTILHTGEKPYTCNECGKVFNRLSTLARHRRLHTGEKPY
KCEECDKVFSRKSHLERHRRIHSGEKPYKCEECCKVFSRKSNLERHRRIHTGEKPYKCKVCDKAFQRDSHLAQHQRVHTGEKPYRCNECGKTFRQTSSLIIHRRLHTGEK
PYKCNECGKAFSQMSSLVYHHRLHSGEKP*
120 >lcl|XP_003316752.1|Plus11807642..1809126 NW_003458538 zinc finger protein 805 isoform 2 ZNF460 __SEG__ Chr19 {Pan troglodytes} MQGECLRPGLDSQKEKLPGKMSPKHDGLGTADSVCSRIIQDQVSLGDDVHDCDSHGSGKNPIIQEEENIFKCNECEKVFNKKRLLARHERIHSGVKPYECTECGKTFSKS
TYLLQHHMVHTGEKPYKCMECGKAFNRKSHLTQHQRIHSGEKPYKCSECGKAFTHRSTFVLHNRSHTGEKPFVCKECGKAFRDRPGFIRHYIIHSGENPYECFECGKVFK
HRSYLMWHQQTHTGEKPYECSECGKAFCESAALIHHYVIHTGEKPFECLECGKAFNHRSYLKRHQRIHTGEKPYVCSECGKAFTHCSTFILHKRAHSGEKPFECKECGKA
FSNRADLIRHFSIHTGEKPYECMECGKAFNRRSGLTRHQRIHSGEKPYECIECGKTFCWSTNLIRHSIIHTGEKPYECSECGKAFSRSSSLTQHQRMHTGRNPISVTDVG
RPFTSGQTSVNIQELLLGKNFLNVTTEENLLQEEASYMASDRTYQRETPQVSSL*
121 >lcl|XP_003316755.1|Plus11974382..1976286 NW_003458538 zinc finger protein 17 isoform 3 ZNF17 __SEG__ Chr19 {Pan troglodytes} MGLPLPSKVNMHFMSISVLGCWHGAKDEEAPSKQCVSVGVSEVTTLKPALSTQKAQPCETCSSLLKDILHLAEHDGTHPKRTAELYLHQKEHLREKLTRSDEGRPSFVND
SVHLAKRNLTCMQGGKDFTGDSDLQQQALHSGWKPHRDTHGVEAFQIGQNDYSCSQCGKDFCHQHRLFEHQKIHTEERPYECSECGKLFRYNSDLNKHQRNHTGERPYKC
SECGKAFSLKYNVVQHQKIHTGERPYECSECGKAFLRKSHLLQHQRIHTRPRPYVCSECGKAFLTQAHLVGHQKIHTGERPYGCNECGKYFMYSSALIRHQKVHTGERPF
CCCECGKFFMDSCTLIIHQRVHTGEKPYECNECGKFFRYRSTLIRHQKVHTGEKPYECSECGKFFMDTSTLIIHQRVHTGEKPYECSKCGKFFRYCFTLNRHQRVHSGER
PYECSECGKFFVDSCTLKSHQRVHTGERPFECSICGKSFRCRSTLDTHQRIHTGERPYECSECGKFFRHNSNHIRHRRNHFGERSFECTECGRVFSQNSHLIRHQKVHTR
ERTYKCSKCGKFFMDSSTLISHERVHTGEKPYECSECGKVFRYNSSLIKHRRIHTGERPYQCSECGRVFNQNSHLIQHQKVHTR*
122 >lcl|XP_003316800.1|Plus1complement(1217488..1219101) NW_003458538 zinc finger protein 835 isoform 1 ZNF835 __SEG__ Chr19 {Pan troglodytes} MEGLLRVALQGAELEGNWKHEGQVEDLQENQESCPEPEAVACKGDPAGDSMQERDEFSRIPRTISSPAATQASVPDDSSSRRCSAPGESPKERHPDSRQRERGGGPKKPW
KCGDCGKAFSYCSAFILHQRIHTGEKPFACPECGKAFSQSVHLTLHQRTHTGEKPYACHECGKAFSQGSYLASHWRTHTGEKPHRCADCGKAFTRVTHLTQHRRVHTGER
PYACAQCAKAFRNRSSLIEHQRIHTGEKPYECSACDKAFRFSSALIRHQRIHTEERPYRCGQCAKAFAQIAHLTQHRRVHTGEKPYTCQDCGALFSQSASLAEHRRIHTG
EKPYACGQCAKAFTQVSHLTQHQRTHTGERPYPCHDCGKRFSNRSHLLQHRLVHTGERPYRCLQCGAAFSHVSSLIEHQKIHTGERPYKCGECGKAFSQGSSLALHQRTH
TGERPYTCPECGKAFSNRSYLIQHHIVHTGEKPYECSGCGKAFSFSSALIRHQRTHADSSGRLCPAPTPDSTPGLSQGGETCQQGCPGRNPRGPAED*
123 >lcl|XP_003316812.1|Plus1complement(2691141..2692766) NW_003458538 zinc finger protein 329 isoform 1 ZNF329 __SEG__ Chr19 {Pan troglodytes} MRLKMTTRNFPEREVPCDVEVERFTREVPCLSSLGDGWDCENQEGHLRQSALTLEKPGTQEAICEYPGFGEHLIASSDLPPSQRVLATNGFHAPDSNVSGLDCDPTLPRY
PKSYADKRTGDSDACGKGFNHSMEVIHGRNPVREKPYKYPESVKSFNHFTSLGHQKIMKRGKKSYEGKNFEDIFTLSSSLNENQRNLPGEKQYRCTECGKCFKRNSSLVL
HHRTHTGEKPYTCNECGKSFSKNYNLIVHQRIHTGEKPYECSKCGKAFSDGSALTQHQRIHTGEKPYECLECGKTFNRNSSLILHQRTHTGEKPYRCNECGKPFTDISHL
TVHLRIHTGEKPYECSKCGKAFRDGSYLTQHERTHTGEKPFECAECGKSFNRNSHLIVHQKIHSGEKPYECKECGKTFIESAYLIRHQRIHTGEKPYGCNQCQKLFRNIA
GLIRHQRTHTGEKPYECNQCGKAFRDSSCLTKHQRIHTKETPYQCPECGKSFKQNSHLAVHQRLHSREGPSRCPQCGKMFQKSSSLVRHQRAHLGEQPMET*
124 >lcl|XP_003316818.1|Plus1<51762..54707 NW_003458538 zinc finger protein 865-like LOC456308 __SEG__ Chr19 {Pan troglodytes} YDYPPSHLQPKAEVPFSSSSSSSSSSSSSSSSSSSSSSSQAKKPDPPLPPAFGAPPPPLFDAAFPTPQWGIVDLSGHQHLFGNLKRGGPASGPGVTPGLGAPAGAPGPLP
APSQTPPGPPAAAACDPTKDDKGYFRRLKYLMERRFPCGVCQKSFKQSSHLVQHMLVHSGERPYECGVCGRTYNHVSSLIRHRRCHKDVPPAAGGPPQPGPQLPPLGLPA
PAASAATAAAPSTVSSGPPATPVAPAPSADGSAAPAGVGVPPPATGGGDGPFACPLCWKVFKKPSHLHQHQIIHTGEKPFSCSVCSKSFNRRESLKRHVKTHSADLLRLP
CGICGKAFRDASYLLKHQAAHAGAGAGGPRPVYPCDLCGKSYSAPQSLLRHKAAHAPPAAAAEAPKDGASSAPQPPPTFPPGPYLLPPDPPTTDSEKAAAAAAAVVYGAV
PVPLLGAHPLLLGGAGTSGAGGSGASVPGKTFCCGICGRGFGRRETLKRHERIHTGEKPHQCPVCGKRFRESFHLSKHHVVHTRERPYKCELCGKVFGYPQSLTRHRQVH
RLQLPCALAGAAGLPSTQGTPGACGPGASGTSAGPTDGLSYACSDCGEHFPDLFHVMSHKEVHMAEKPYGCDACGKTFGFIENLMWHKLVHQAAPERLLPPAPGGLQPPD
GSSGTDAASVLDNGLAGEVGAAVAALAGVSGGEDAGGAAVAGAGGGASSGPERFSCATCGQSFKHFLGLVTHKYVHLVRRTLGCGLCGQSFAGAYDLLLHRRSHRQKRGF
RCPVCGKRFWEAALLMRHQRCHTEQRPYRCGVCGRGFLRSWYLRQHRVVHTGERAFKCGVCAKRFAQSSSLAEHRRLHAVARPQRCSACGKTFRYRSNLLEHQRLHLGER
AYRCEHCGKGFFYLSSVLRHQRAHEPPRPELRCPACLKAFKDPGYFRKHLAAHQGGRPFRCSSCGEGFANTYGLKKHRLAHKAENLGGPGAGAGTLAGKDA*
125 >lcl|XP_003316960.1|Plus1complement(1143633..1144859) NW_003458553 zinc finger protein PLAGL2 isoform 2 PLAGL2 __SEG__ Chr20 {Pan troglodytes} MATHSAQKPHQCMYCDKMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSRRVAGGAKEKKHPCDHCDR
RFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSHSQELLKIKTEPVDMLGLLSCSSTVSVKEELSPVLCMASRDVMGTKAFPGMLPMGMYGAHIPTMPST
GVPHSLVHNTLPMGMSYPLESSPISSPAQLPPKYQLGSTSYLPDKLPKVEVDSFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAKSPANLSEALCAANVDFSHLL
GFLPLNLPPCNPPGATGGLVMGYSQAEAQPLLTTLQAQPQDSPGAGGPLNFGPLHSLPPVFTSGLSSTTLPRFHQAFQ*
126 >lcl|XP_003317282.1|Plus11412674..1413081 NW_003458656 transcription factor MafF isoform 5 MAFF __SEG__ Chr22 {Pan troglodytes} MGLSVRELNRHLRGLSAEEVTRLKQRRRTLKNRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQGFARSVAAARGPATLVAPASVITI
VKSTPGSGSGPAPGPDPAHGPASCS*
127 >lcl|XP_003317440.1|Plus1254427..256961 NW_003458811 protein FAM48B1-like LOC100610514 __SEG__ ChrX {Pan troglodytes} MDRDLEQALDRAENIIEIAQQRPPRRRYSPRAGKTLQEKLYDIYVEECGKEPEDPQELRSNVNLLEKLVRRESLPCLLVNLYPGNQGYSVMLQREDGSFAETIRLPYEER
ALLDYLDAEELPPALGDVLDKASVNIFHSGCVIVEVRDYRQSSNMQPPGYQSRHILLRPTMQTLAHDVKMMTRDGQKWSQEDKLQLESQLILATAEPLCLDPSVAVACTA
NRLLYNKQKMNTDPMKRCLQRYSWSSVKPQQEQSDCPPPPELRVSTSGQKEERKAGQPCELNIAKAGSCVDTWKRTPCDLAVPSEVDVEKLAKGYQSVTAADPQLPVWPA
QEVEDPFGFAWEAGCQAWDTKPSIMQSFNDPLLCGKIRPRKKARQKSQKSPWQPFPDDHSACLRPGSETDAGRAVSQAQESVQSKVKGPGKMSHSSSGPASVSQLSSWKT
PEQPDPVWVQSSVSGKGEKHPPPRTQLPSSSRKISSGNSFPPQQAGSPLKRPFSAAAAIVAAAAAAAAAAPAVAAAPAAAPAAAASAAPSHSQKPSVPLIQVSRPCPAAQ
PPTKFIKIAPAIQLRTGSTGLKAINVEGPVQGAQALGSSFKPVQAPGSGAPAPAGISGSGLQSSGGPLPDARPGAVQASSPAPLQFFLNTPEGLRPLTLLQVPQGSAVLT
GPQQQSHQLVSLQQLQQPTAAHPPQPGPQGSALGLSTQGQAFPAQQLLKVNPTRARSGLQPQPQAAVLSLLGSAQVPQQGVQLPSVLRQQQPQPQPLKLQLQPQWQPQPR
QEQPQSQQQQPQHIQLQTQQLRVLQQPQHIQLQTQQPVFLATGAVQVVQPHPGVQVVSQLVGQRKEGKPTPPAP*
128 >lcl|XP_003317585.1|Plus1525333..526418 NW_003459066 POU domain, class 3, transcription factor 4-like LOC100615412 __SEG__ ChrX {Pan troglodytes} MATAASNPYSILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNH
PNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALG
TLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRR
QKEKRMTPPGDQQPHEVYSHTVKTDTSCHDL*
129 >lcl|XP_003317692.1|Plus1375296..375901 NW_003459141 high mobility group protein B3-like LOC473737 __SEG__ ChrX {Pan troglodytes} MAEGDHKKPKGKMSAYAFFAQTCREEHKKKNPEVPVNFVEFSKKCSEKRKTMSGKEKTKFDEMAKVDKVHYDQEMKDNGPVEGGKKKDPNALKRPLSGFFLFCSEFHPKI
KSTNPGISIGDMAKKLGEMWINYSDREKQPYITKAADLKEKYEKDVADYKSKGKFDSAKGPTKIAWKKVKEKDKEDEEEEEEEEEKKEEGE*
130 >lcl|XP_003317742.1|Plus1complement(2098582..2099799) NW_003459209 transcription factor Dp family member 3 TFDP3 __SEG__ ChrX {Pan troglodytes} MAKYVSLTEANEELKVLIDQNQTSRPVAVHPSTVNPLGKQLLPKTFGQSSVNIDQQVVIGMPQRPAASDVPVVGSPNPPSTHFASQNQHSYSSPPWARQHNRKGEKNGMG
LCRLSMKVWETVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNIKRRTYDALNVLMAMNIISREKKKIKWIGLTTNSAQNCQNLRVERQKRLERIKQKQSELQQ
LILQQIAFKNLVLRNQYVEEQVGQRPPPNSVVHMPFIIISSSKKTVINCRISNDESEYLFNFNSSIEIHDDTEVLMWMGMAFGLESGSCSAEDLKMARNLVPKALEPYVT
EMAQGTSGGVFTTAGSRSNGTWLSASDLTNIAIGLLATSSDGSQYSGSRVETPAVEEEEEEDNNDDDFSENDEDD*
131 >lcl|XP_003317906.1|Plus11260..1892 NW_003463292 high mobility group protein B1-like HMGB1P1 __SEG__ Chr3 {Pan troglodytes} MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKEETKKKFKDPNAPKRPPSAFFLFCSEYR
PKIKGEHPGLSVGDVAKKLGEMWNNAAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEEDDDDE*
132 >lcl|XP_003317969.1|Plus1complement(3509..3841) NW_003469156 prothymosin alpha-like LOC738633 __SEG__ Chr9 {Pan troglodytes} MSDAAVDTSSEIIAKDLKEKKEVVKAAENGRDAPANGNANEENGEQEADNEVDEEGEESGEEEEEEKEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDKDD
*
133 >lcl|XP_003317982.1|Plus1complement(11148..11480) NW_003469510 prothymosin alpha-like LOC743312 __SEG__ Chr9 {Pan troglodytes} MSDAAVDTSSEIIAKDLKEKKEVVKAAENGRDAPANGNANEENGEQEADNEVDEEGEESGEEEEEEKEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDKDD
*
134 >lcl|XP_003318052.1|Plus1complement(<61..>612) NW_003472301 mRNA-decapping enzyme 1B-like LOC749507 __SEG__ Chr12 {Pan troglodytes} TLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQQQQQQQQQQEKLPIRQGVVRSLSYEEPRRHSPPIEKQLCPAIQKLMVRSGDLHPLSELPENRPCENGSTHSA
GEFFTGPVQPGSPHNIGTSHGVQNASRTQNLFEKLQSTPGAANKCDPSTPAPASSAALNRSRAPTSVTPVAPGK
135 >lcl|XP_003318389.1|Plus1complement(17572254..17573723) NW_003457175 transcription factor Sp8 SP8 __SEG__ Chr7 {Pan troglodytes} MLAATCNKIGSPSPSPSSLSDSSSSFGKGFHPWKRSSSSSSASCNVVGSSLSSFGVSGASRNGSSSSAAAAAAAAAAAAAALVSDSFSCGGSPGSSAFSLTSSSAAAAAA
AAAAAASSSPFANDYSVFQAPGVSGGSGGGGGGGGGGSSAHSQDGSHQPVFISKVHTSVDGLQGIYPRVGMAHPYESWFKPSHPGLGAAGEVGSAGASSWWDVGAGWIDV
QNPNSAAALPGSLHPAAGGLQTSLHSPLGGYNSDYSGLSHSAFSSGASSHLLSPAGQHLMDGFKPVLPGSYPDSAPSPLAGAGGSMLSAGPSAPLGGSPRSSARRYSGRA
TCDCPNCQEAERLGPAGASLRRKGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLSKHVKTHSG
GGGGGSAGSGSGGKKGSDTDSEHSAAGSPPCHSPELLQPPEPGHRNGLE*
136 >lcl|XP_003318463.1|Plus1complement(631795..632733) NW_003457177 transcriptional activator protein Pur-beta-like isoform 1 LOC472357 __SEG__ Chr7 {Pan troglodytes} MADGDSGSERGGGGGPGGFQPASRGGGEQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAE
EGGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTVNRGGGGFGAGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDELAGGPGGGAGGPGGGLYGELP
EGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMKEIQERQRDKLYERRGGGSGGGEESEGEEVDED*
137 >lcl|XP_003318502.1|Plus1complement(5749342..5749635) NW_003457178 uncharacterized protein LOC389493-like LOC746509 __SEG__ Chr7 {Pan troglodytes} MEAAAERALPRLQGLARPPPPISYEEELYDCLDYYYLRDFPACGAGRSKGRTRREQALRTNWPAPGGHERKVAQKLLNGQRKRRQRQLQPRLRTRLT*
138 >lcl|XP_003318514.1|Plus11770085..1771617 NW_003457182 zinc finger protein 92 isoform 5 ZNF92 __SEG__ Chr7 {Pan troglodytes} MCSHFAQDVWPEHSIKDSFQKVILRTYGKYGHENLQLRKDHKSVDACKVYKGGYNGLNQCLTTTDSKIFQCDKYVKVFHKFPNVNRNKIRHTGKKPFKCKNRGKSFCMLS
QLTQHKKIHTREYSYKCEECGKAFNWSSTLTKHKIIHTGEKPYKCEECGKAFNRSSNLTKHKIIHTGEKPYKCEECGKAFNRSSTLTKHKRIHTEEKPYKCEECGKAFNQ
FSILNKHKRIHMEDKPYKCEECGKAFRVFSILKKHKIIHTGEKPYKCEECGKAFNQFSNLTKHKIIHTGEKPYKCDECGKAFNQSSTLTKHKRIHTGEKPYKCEECGKAF
KQSSTLTEHKIIHTGEKPYKCEKCGKAFSWSSAFTKHKRNHMEDKPYKCEECGKAFSVFSTLTKHKIIHTREKPYKCEECGKAFNQSSIFTKHKIIHTEGKSYKCEKCGN
AFNQSSNLTAHKIIYTGEKPYKYEECDKAFNKFSTLITHQIIYTGEKPCKHECGRAFNKSSNYTKEKLQT*
139 >lcl|XP_003318622.1|Plus1complement(20406626..20407765) NW_003457184 transcription termination factor, mitochondrial MTERF __SEG__ Chr7 {Pan troglodytes} MAPGNLWHMRNNFLFGSRCWMTRFSAEIIFKSVSFRLFGVKCHNADSEPLKNEDLLKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEVIASIISRYPR
AITRTPENLSKRWDLWRKIVTSDLEIVNILERSPESFFRSNNNLNLENNIKFLYSVGLTRKCLCRLLTNAPRTFSNSLDLNKQMVEFLQAAGLSLGHNDPTDFVRKIIFK
NPFILIQSTKRVKANIEFLQSTFNLNSEELLVLICGPGAEILDLSNDYARRSYANIKEKLFSLGCTEEEVQKFVFSYPDVIFLAEKKFNDKIDCLMEENISISQIIENPR
VLDSSISTLKSRIKELVNAGCNLSTLNITLLSWSKKRYEAKLKKLSRFA*
140 >lcl|XP_003318686.1|Plus128121295..28122281 NW_003457184 zinc finger protein 655-like LOC100612008 __SEG__ Chr7 {Pan troglodytes} MSFNQNSASGKHEHLNLTEDFQSSECKESLMDLSHLNKWESIPNTEKSYKCDVCGKIFHQSSALTRHQRIHTREKPYKCKECEKSFSQSSSLSRHKRIHTREKPYKCEAS
DKSCEASDKSCSPSSGIIQHKKIHTRAKSYKCSSCERVFSRSVHLTQHQKIHKEMPCKCTVCGSDFCHTSYLLEHQRVHHEEKAYEYDEYGLAYIKQQGIHFREKPYTCS
ECGKDFRLNSHLIQHQRIHTGEKAHECNECGKAFSQTSCLIQHHKMHRKEKSYECNEYEGSFSHSSDLILQQEVLTRQKAFDCDVWEKNSSQRAHLVQHQSIHTKENS*
141 >lcl|XP_003318849.1|Plus1complement(17937609..17938580) NW_003457186 Kruppel-like factor 14 KLF14 __SEG__ Chr7 {Pan troglodytes} MSAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAPPESALPGPGPPGPASVPPLPQVPAPSPGAGGAAPHLLAASVWADLRGSSGEGSWENSGEAPRA
SSGFSDPIPCSVQTPCSELAPASGAAAVCAPESSSDAPAVPSAPAAPGAPAASGGFSGGALGAGPAPAADQVPRRRPVTPAAKRHQCPFPGCTKAYYKSSHLKSHQRTHT
GERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTYHPDMIEYRGRRRTPRIDPPLTSEVESSASGSGPGPAPSFTTCL*
142 >lcl|XP_003318944.1|Plus1370131..370742 NW_003457188 zinc finger protein 84-like LOC100612560 __SEG__ Chr7 {Pan troglodytes} MTELASSGGGSPAGDGEEGLGDERGLVIHHPAEEQPYRCPLCGQTFSQQPSLVRHQKAHAGAGRAAAFVCPECGKAFSVKHNLEVHQRTHTGERPFPCPECGRCFSLKQN
LLTHQRIHSGEKPHQCAQCGRCFREPRFLLNHQRTHARMPAPHPRRPGVFGERRPYFCPRCGKSFAREGSLKTHQRSHGHGPEGQAAHLGRVL*
143 >lcl|XP_003319081.1|Plus1complement(16619911..16620156) NT_106996 keratin-associated protein 19-3-like LOC745513 __SEG__ Chr21 {Pan troglodytes} MSYYGSYYGGLGYGCGGFGGLGYGYGCGCGSFRRLGSGCGYGGYGYGSGFGGYGYGSGFGGYGYGCYRPSYYGGYGFSGCY*
144 >lcl|XP_003319084.1|Plus116719457..16719627 NT_106996 keratin-associated protein 20-1 KRTAP20-1 __SEG__ Chr21 {Pan troglodytes} MIYYSNYYGGYGYGGLGCGYGCGYRGYGCGYGGYGGYGNGYCCPSCYGRYWSYGFY*
145 >lcl|XP_003319099.1|Plus119130082..19131053 NT_106996 oligodendrocyte transcription factor 2 isoform 2 OLIG2 __SEG__ Chr21 {Pan troglodytes} MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLR
LKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHP
ILPPAAAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAK*
146 >lcl|XP_003339220.1|Plus1complement(1510881..1512269) NW_003457460 nuclear factor interleukin-3-regulated protein NFIL3 __SEG__ Chr9 {Pan troglodytes} MQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEELLLSEGSVGKNKSSACRRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGE
ENATLKAELLSLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKSNVSSFVDEHEPSMVSSSCISVIKHSPQSSLSDVSEVSSVEHTQESSVQGSCRSPENKFQIIKQ
EPMELESYTREPRDDRGSYTASIYQNYMGNSFSGYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIHSPVELKHVHATVVKVPEVNSSALPHKLRIK
AKAMQIKVEAFDNEFEATQKLSSPIDMTSKRHFELEKHSAPSMVHSSLTPFSVQVTNIQDWSLKSEHWHQKELSGKTQNSFKTGVVEMKDSGYKVSDPENLYLKQGIANL
SAEVVSLKRLIATQPISASDSG*
147 >lcl|XP_003339288.1|Plus1498681..499466 NW_003457741 zinc finger protein 664-like LOC746079 __SEG__ Chr12 {Pan troglodytes} MIYKCPMCREFFSERADLFMHQKIHTAEKPHKCDKCDKGFFHISELHIHWRDHTGEKVYKCDDCGKDFSTTTKLNRHKKIHTVEKPYKCYECGKAFNWSSHLQIHMRVHT
GEKPYVCSECGRGFSNSSNLCMHQRVHTGEKPFKCEECGKAFRHTSSLCMHQRVHTGEKPYKCYECGKAFSQSSSLCIHQRVHTGEKPYRCCGCGKAFSQSSSLCIHQRV
HTGEKPFKCDECGKAFSQSTSLCIHQRVHTKERNHLKISVI*
148 >lcl|XP_003339425.1|Plus1complement(95..880) NW_003472471 zinc finger protein 664-like LOC100608269 __SEG__ Chr12 {Pan troglodytes} MIYKCPMCREFFSERADLFMHQKIHTAEKPHKCDKCDKGFFHISELHIHWRDHTGEKVYKCDDCGKDFSTTTKLNRHKKIHTVEKPYKCYECGKAFNWSSHLQIHMRVHT
GEKPYVCSECGRGFSNSSNLCMHQRVHTGEKPFKCEECGKAFRHTSSLCMHQRVHTGEKPCKCYECGKAFSQSSSLCIHQRVHTGEKPYRCCGCGKAFSQSSSLCIHQRV
HTGEKPFKCDECGKAFSQSTSLCIHQRVHTKERNHLQISVI*
149 >lcl|XP_508678.2|Plus1complement(14875668..14876732) NW_003457698 CREB/ATF bZIP transcription factor CREBZF __SEG__ Chr11 {Pan troglodytes} MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETATAGSPGREQQFGDEGELEAGRGSRGGVAVRAPSPEEMEEEAIASLPGEETEDMDFLSGLELADL
LDPRQPDWHLDPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARL
NRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLH
VDKDKVSVEFCSACARKASSSLKM*
150 >lcl|XP_509133.2|Plus1complement(12053862..12055166) NW_003457722 zinc finger CCCH domain-containing protein 10 ZC3H10 __SEG__ Chr12 {Pan troglodytes} MPDRDSYANGTGSSGGGPGGGGSEEASGAGAGSGGASSDAICRDFLRNVCKRGKRCRYRHPDMSEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGE
LPPRLRQKVAAGLGLSPADLPNGKEEVPICRDFLKGDCQRGAKCKFRHLQRDFEFDARGGGGTGGGSTGSVLPGRRHDLYDIYDLPDRGFEDHEPGPKRRRGGCCPPDGP
HFESYEYSLAPPRGVECRLLEEENAMLRKRVEELKKQVSNLLATNEVLLEQNAQFRNQAKVITLSSTAPATEQTLAPTVGTVATFNHGIAQTHTTLSSQALQPRPVSQQE
LVAPAGAPAAPPTNAAPPAAPPPPPPHLTPEITPLSAALAQTIAQGMAPPPVSMAPVAVSVAPVAPVAVSMAQPLAGITMSHTTTPMVTYPIASQSMRITAMPH*
151 >lcl|XP_511041.1|Plus1828301..829236 NW_003458198 THAP domain-containing protein 11 THAP11 __SEG__ Chr16 {Pan troglodytes} MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQ
QQQQQQQQQQQQQQQQQQQSSPSASTAQTAQLQPNLVSASAAVLLTLQAAVDSSQAPGSVQPAPITPTGEDVKPIDLTVQVEFAAAEGAAAAAAASELQAATAGLEAAEC
PMGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRLLAMAVIRKKHGM*
152 >lcl|XP_511154.2|Plus11094366..1095403 NW_003458219 forkhead box protein L1 FOXL1 __SEG__ Chr16 {Pan troglodytes} MSHLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKV
PREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPGPGAPEAKRPRAETHERSAEAQPEAGSGAGGSGPAISRLEAAPAGPSPLLDGPSPPAPLHWPGTAFQNEDAGD
AAQGAAAVAVGQPARTGDGPGSPLRPASRSSPKSSDKSKSFSIDSILAGKQGQKPPSADELLGGVKPGPGGRLGASLLAASSSLRPPFNASLMLDPHVQGGFYQLGIPFL
SYFPLQLPDTVLHFQ*
153 >lcl|XP_511456.2|Plus13649705..3650853 NW_003458268 neurogenic differentiation factor 2 isoform 2 NEUROD2 __SEG__ Chr17 {Pan troglodytes} MLTRLFSEPGLLSDVPKFASWGDGEDDEPRSDKGDAPPPPPPAPGPGAPGPARAAKPVPLRGEEGTEATLAEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRK
MTKARLERSKLRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQG
ADGAGRFHGSGGPFAMHPYPYPCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLSPPLCLNGNFSLKQDSSPDHEKSYHYSMHYS
ALPGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPVYEELNAFFHN*
154 >lcl|XP_511608.1|Plus1complement(1504763..1505410) NW_003458346 nascent polypeptide-associated complex subunit alpha-2 NACA2 __SEG__ Chr17 {Pan troglodytes} MPGEATETVPATEQELPQPQAETGSGTASDSGESVPGLEEQDSTQTTTQKAWLVAAAEIDEEPVSKAKQSRSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKPD
VYKSPASDAYIVFGEAKIQDLSQQAQLAAAEKFKVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKDMKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV*
155 >lcl|XP_511929.2|Plus15327793..5328923 NW_003458253 transcription factor Sp6 SP6 __SEG__ Chr17 {Pan troglodytes} MLTAVCGSLGSQHTEAPHASPPRLDLQPLQTYQGHTSPEAGDYPSPLQPGELQSLPLGPEVDFSQGYELPGASSRVTCEDLESDSPLAPGPFSKLLQPDMSHHYESWFRP
THPGAEDGSWWDLHPGTSWMDLPHTQGALTSPGHPGALQAGLGGYVGDHQLCAPPPHPHAHHLLPAAGGQHLLGPPDGAKALEVAAPESQGLDSSLDGAARPKGSRRSVP
RSSGQTVCRCPNCLEAERLGAPCGPDGGKKKHLHNCHIPGCGKAYAKTSHLKAHLRWHSGDRPFVCNWLFCGKRFTRSDELQRHLQTHTGTKKFPCAVCSRVFMRSDHLA
KHMKTHEGAKEEAAGAASGEGKAGGAVESPGGKGKREAEASVAPSN*
156 >lcl|XP_512328.2|Plus172904..74583 NW_003458446 uncharacterized protein C19orf45 isoform 4 ZNF358 __SEG__ Chr19 {Pan troglodytes} MRRSVLVRNPGHKGPRPVYEELDSDSEDLDPNPEDLDPVSEDPEPDPEDLNTVPEDVDPSYEDLEPVSEDLDPDAEAPGSEPQDPDPMSSSFDLDPDVIGPVPLILDPNS
DTLSPGDPNVDPISSGLTATPQVLATSPAVLPAPASPPRPFSCPDCGRAFRRSSGLSQHRRTHSGEKPYRCPDCGKSFSHGATLAQHRGIHTGARPYQCAACGKAFGWRS
TLLKHRSSHSGEKPHHCPVCGKAFGHGSLLAQHLRTHGGPRPHKCPVCAKGFGQGSALLKHLRTHTGERPYPCPQCGKAFGQSSALLQHQRTHTAERPYRCPHCGKAFGQ
SSNLQHHLRIHTGERPYACPHCSKAFGQSSALLQHLHVHSGERPYRCQLCGKAFGQASSLTKHKRVHEGAAAAAAAAGLGLGPGLSPASMMRPGQVSLLGPDAVSVLGSG
LGLSPGTSSGRNPDPGSGPGILLDPSSKPLPGSRSTPSPTPVESSDPKAGHDAGPDLVPSPDLDPVPSPDPDPVPSPDPNPVSCPDPCSPTRGTVSPALPTGKSPEWVQE
QGALLGPDG*
157 >lcl|XP_512433.2|Plus12242521..2243366 NW_003458474 elongation factor 1-delta-like LOC455775 __SEG__ Chr19 {Pan troglodytes} MATNFLAHEKIWFDKFKYDDAERRFYQQMNGPVAGASRQENGASVILHDIVRARENIQKSLAGSSGPGASSGPSGDHSELVVQIASLEVENQSLRGVVQELQQAISKLEA
QLNVLEKSSPGHRATAPQTQHVSPMRQVESPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREEWLRQYAEKKAKKPALVAKSSILLDVKLWDDETDMAQLEACVRS
IELDGLVWGTSKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI*
158 >lcl|XP_512927.3|Plus11174147..1175616 NW_003458538 endothelial zinc finger protein induced by tumor necrosis factor alpha ZNF71 __SEG__ Chr19 {Pan troglodytes} MKELDPKNDISEDKLSVVGVATGGPTRNGARGPGSEGVWEPGSWPERPRGDAGAEWEPLGIPQGNKLLGGSVPACHELKAFVNQSCVLVPPRLDDPTEKGACPPIRRGKN
FSSTSDLSKPPMPCEEKKTYDCSECGKAFSRSSSLIKHQRIHTGEKPFECDTCGKHFIERSSLTIHQRVHTGEKPYACGDCGKAFSQRMNLTVHQRTHTGEKPYVCDVCG
KAFRKTSSLTQHERIHTGEKPYACGDCGKAFSQNMHLIVHQRTHTGEKPYVCPECGRAFSQNMHLTEHQRTHTGEKPYACKECGKAFNKSSSLTLHQRNHTGEKPYVCGE
CGKAFSQSSYLIQHQRFHIGVKPFECSECGKAFSKNSSLTQHQRIHTGEKPYECYICKKHFTGRSSLIVHQIVHTGEKPYVCGECGKAFSQSAYLIEHQRIHTGEKPYRC
GQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNTNLTRHLRIHT*
159 >lcl|XP_513442.2|Plus1complement(3919663..3920658) NW_003456532 transcription factor AP-1 JUN __SEG__ Chr1 {Pan troglodytes} MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGF
AEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHP
RLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQT
F*
160 >lcl|XP_513453.2|Plus1704572..706008 NW_003456534 forkhead box protein D3 FOXD3 __SEG__ Chr1 {Pan troglodytes} MTLSGGGSASDMSGQTVLTAEDVDIDVVGEGDDGLEEKDSDAGCDSPAGPPELRLDEADEVPPAAPHHGQPQPPHQQPLTLPKEAAGAGAGLGGDVGAPEADGCKGGVGG
EEGGASGGGPGAGSGSAGGLAPSKPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQ
SEDMFDNGSFLRRRKRFKRHQQEHLREQTALMMQSFGAYSLAAAAGAAGPYGRPYGLHPAAAAGAYSHPAAAAAAAAAAALQYPYALPPVAPVLPPAVPLLPSGELGRKA
AAFGSQLGPGLQLQLNSLGAAAAAAGTAGAAGTTASLIKSEPSARPSFSIENIIGGGPAAPGGSAAGAGVAGGTGGSGGGSTAQSFLRPPGTVQSAALMATHQPLSLSRT
TATIAPILSVPLSGQFLQPAASAAAAAAAAAQAKWPAQ*
161 >lcl|XP_513604.2|Plus12633988..2635115 NW_003456554 protein arginine N-methyltransferase 6 PRMT6 __SEG__ Chr1 {Pan troglodytes} MSQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYA
VEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQMLEWRLGFWSQVKQHYGVDMS
CLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLYLNEPVQ
VEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAMED*
162 >lcl|XP_514561.3|Plus1complement(1783416..1785284) NW_003458549 zinc finger protein 337 isoform 2 ZNF337 __SEG__ Chr20 {Pan troglodytes} MAFSSPPLRHAVSSRRRNSVVEIESSQGQRENPTEIDKVLKGIENSRWGAFKCAERGQDFSRKMMVIIHKKAHSRQKLFTCRECHQGFRDESALLLHQNTHTGEKSYVCS
ECGRGFSLKANLLRHQRTHSGEKPFLCKVCGRGYTSKSYLTVHERTHTGEKPYECQECGRRFNDKSSYNKHLKAHSGEKPFVCKECGRGYTNKSYFVVHKRIHSGEKPYR
CQECGRGFSNKSHLITHQRTHSGEKPFACRQCKQSFSVKGSLLRHQRTHSGEKPFVCKDCERSFSQKSTLVYHQRTHSGEKPFVCRECGQGFIQKSTLVKHQITHSEEKP
FVCKDCGRGFIQKSTFTLHQRTHSEEKPYGCRECGRRFRDKSSYNKHLRAHLGEKRFFCRDCGRGFTLKPNLTIHQRTHSGEKPFMCKQCEKSFSLKANLLRHQWTHSGE
RPFNCKDCGRGFILKSTLLFHQKTHSGEKPFICSECGQGFIWKSNLVKHQLAHSGKQPFVCKECGRGFNWKGNLLTHQRTHSGEKPFVCNVCGQGFSWKRSLTRHHWRIH
SKEKPFVCQECKRGYTSKSDLTVHERIHTGERPYECQECGRKFSNKSYYSKHLKRHLREKRFCTGSVGEASS*
163 >lcl|XP_516171.1|Plus1complement(710291..711364) NW_003456855 putative male-specific lethal-3 protein-like 2-like LOC460035 __SEG__ Chr2B {Pan troglodytes} MEERTVTLEIPEVLKRQLEDDCYYINRRKRLVQLPCHTNIITILESYVKHFAISAAFSANERPRHHHAMPHASMNVPYIPAEKNVDLCKEMVDGLRITFDYTLPLVLLYP
YEQAQYKKVTASKVFLAIKESATNTNRSQETLSPSLRLLNPSRPQSAESQSTSGEPATPKRRKAEPQAVQSLRRSSPHTANCDRLSKSSTSPQPKRWQQDMSTSVPKLFL
HLEKKTPVHSRSSSPTPLTPSQEGSPVFAGFEGRRTNEINEVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVKLPEILGKMSFTEKNLKALLKHFDLFVRFLAEYHD
DFFPESAYVAASEVHYSTRNPQAVNKC*
164 >lcl|XP_516348.2|Plus123013217..23015199 NW_003456875 zinc finger protein 860-like ZNF860 __SEG__ Chr3 {Pan troglodytes} MLREEAAQKRKEKEAGMALPQGHLTFRDVDIEFSLEEWKCLDHTQRALYRAMMLENYRNLHSVDISSKCMMKKFSSTAQGNTEVDTGTLERHESHHIGDFCFQKIGKDIH
DFEFQWQEDKRNSHEATMTQIKKLTGSTDRYDRRHPGNKPIKDQLGLSFHSHLPELHIFQTQGKVGNQVEKSINDASSVLTSQRISSRPKIHISNNYENNFFHSSLLTQK
QEVHMREKSFQCNESGKAFNFSSLLRKHQIIYLGGKQYKCDVCGKVFNQKRYLACHHRCHTGEKPYKCNECGKVFNQQSNLASHHRLHTGEKPYKCEECDKVFSRKSNLE
RHRRIHTGEKPYKCKVCDKAFRRDSHLAQHTRIHTGEKPYKCNECGKAFSGQSTLIHHQAIYGIGKLYKCNDCHKVFSNATTIANHWRIHNEERSSKCNECGKFFRHRSY
LVVHWRTHTGEKAYKCNERGKTFSQTSSLVCHHRLHTGEKPYKCNECGKTFRHNSALVIHKAIHTGEKPYKCNECGKVFNQQATLAHHHRLHTGEKPYKCNECGNVFNQQ
ATLARHHRLHTGEKPYKCEECDKVFSRKSHHETHKRIHTGEKPYKCDDFDEAFSQASSYAKQRRIHMGEKHHKCDDCGKAFTSHSHLIRHQRIHTGQKSYKCHKRGKVFS
*
165 >lcl|XP_516895.3|Plus136381064..36382023 NW_003456894 transcription factor SOX-2 SOX2 __SEG__ Chr3 {Pan troglodytes} MYNMMETELKPPGPQQTSGGGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDY
KYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMN
GSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPGGPRRDHMSQHYQSGPVPGTAINGTLPLSHM*
166 >lcl|XP_520241.3|Plus1complement(1113971..1115296) NW_003457478 zinc finger and BTB domain-containing protein 26 ZBTB26 __SEG__ Chr9 {Pan troglodytes} MSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDIEVQGHKIVFAAGSPFLRDQFLLNDSREVKISILQSSEVGRQLLLSCYSGVLEFPEMELVNYLTAASFL
QMSHIVERCTQALWKFIKPKQPMDSKEGCEPQSASPQSKEQQGDARGSPKQDSPCIHPSEDSMDMEDSDIQIVKVESIGDVSEVRSKKDQNQFISSEPTALHSSEPQHSL
INSTVENRVSEIEQNHLHNYALSYTGSDNIIMASKDVFGPNIRGVDKGLQWHHQCPKCTRVFRHLENYANHLKMHKLFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKI
CGKTFSQKCSLQDHLNLHSGDKPHKCNYCDMVFAHKPVLRKHLKQLHGKNSFDNANERNVQDLTVDFDSFACTTVTDSKGCQPQPDATQVLDAGKLAQAVLNLRNDSTCV
N*
167 >lcl|XP_520846.3|Plus1complement(5545670..5549746) NW_003457860 LOW QUALITY PROTEIN: retrotransposon-like 1 RTL1 __SEG__ Chr14 {Pan troglodytes} MIEPSEDSFETMMEHKNPSSKQMESSEGSSNTTEATSGSGVRGEAGPASGPAQEKKEPPSGPLQEMEELPTDLLQDMEEPSSGPRKEIEDPPNDLLQDLEESCNGSHQAR
GDPLSGASDRMKEASVNPSGAREEQEAHTDLKESGREETPQEEQNQTEHSAAELMAMVRSIISLYFRMQDLKEQQRVAEEILIKGINAGQLPAPKHFSGDRREFHEFIVL
CQLTLQSYPRMFYNDRLRVGYVINHLSGLALEWAKALLQENSPLIGDFPAFLEAMSEVFEYRQALRVAEEAMFTIRQGGRSATEYIDEFQSLVPILGWPDEVLQAHLCQG
LNEEIRHYLFRVPQPDSLDSLIVLILQIEEKLAERELCSGCPPRPAPGT*PGSTHLLQRGGWSAAGCPAKSIRTSIAPTSSCCSW*E*TPTTASRSRPWWIRELTATSWM
RSSPKSTTSSSTRSRTHSRSNPWTAR*LATSLSGSTRSPWCVSTRTTRSPSNLTSYLHRTSLWS*ASAGSESTPPKSTGSKAAAPSTLPTA*RTASARPRHALP*RGTA*
ACYPDCHTHTQTWPTCLTRRKQMMRLPTSQAQTDPMIFLNQSPLSFSRLETVITARPFTSVPPPRLGNLWVPGCKKEPGYRRNTGTCRTC*PTDRTTYR*FRNCLTSYTE
PSGSQNWSCVGPLWRKA*TGTAPKMCGKQRLVWSLKR*RATSRSRSPQTLSYLRT*FTSS*RTC*GSLCFLMVRKSSSTQ*VRRSTSTTSAKSWSASATTTSTAPWTRAS
STAKPWNSWASSSPPKG*N*TRTS*PS*QGTLPLAPSYLCETSSNSSSPTATSWSASASSQSPWCGSC*APTSSTGESRSRRPSSA*RGLSARRLSSTTPSPRTHSTWKP
ASPARPCTPP*SKSTTKPAREPAALSTPATSPLSRLSTLERR*RFFQYGLPSWCGAATWRTPRSPS*SFSTQRI*PL*IMTGSPYFSPGIGSSSSPTSTLTSWSCQNKTA
AELCHL*ETSGGGEPSRGTLRPGKPCCWPQGDSPGIHRRNPGKKRMKNRMSPMNRPYGKSCWP*YPSTRSSTASSPTSAWPRSGPSFCTSSEASCTGRTP*PWQPSSCYC
A*GSASRCGRHPPCRWLGPSPSAPYDSSWIRPSSQAAASRQPSPSCSPRCPLS*AQTPSQPRSWLSCSWALAAGSEMLCTPRPTEACSSPLASG*RCVSSSVSESPPRRA
TSLPCVRTATWSCTSLVMRMSSCEKPCKTTCNVTVSVACMTACKTPRRTSRTTTCRRPHPATQQPPTHPAHAT*WIPRSWNSLVAACSTSAVRMASCTCSAGSRQPGP*A
SS*P*STGGPCPSPPGRASPGSRQG*KSCLMRTKMLTST
168 >lcl|XP_520983.2|Plus1complement(682637..683314) NW_003458811 elongation factor 1-beta-like LOC465545 __SEG__ ChrX {Pan troglodytes} MGFGDLKSPAGLQVLNDYLADKSYIKGYVPSQADVAVFEAVSSPLPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEE
ESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEERVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVA
AFNKI*
169 >lcl|XP_521363.2|Plus1complement(161059..162288) NW_003458835 transcription factor Dp-1 TFDP1 __SEG__ ChrX {Pan troglodytes} MAKDAGLIEANGELKVFIDQNLSSGKGVVSLVAVHPSTVNPLGKQLLPKTFGQSNVSIAQQVVIGMPQRPAASNTLVVGSSHTPSTHFASQNQPSDSSPRSAGKRNRKGE
NCKGLRHFSMKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQS
QLRELILQQIAFKNLVQRNRHAEQQASRPPPPNSVIHLPFIVVNTSKKTVIDCSISNDKLEYLFNFDNTFEIQGDIEVLKQMGMACWLESGSCSAEDLKMARSLVPKALE
PYVTEMAQGTVGGVFVTAAVSTSKGTRFSASDLTNGADGMLATSSKRSQYSGSRVETPVSYVGEDDEEDDDFNENDKDD*
170 >lcl|XP_521459.1|Plus12799561..2800235 NW_003457543 zinc finger protein 22 ZNF22 __SEG__ Chr10 {Pan troglodytes} MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSLDDKPYKCTECEKSFSQSSTLFQHQKIHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKP
YKCDECGESFKQSSNLIQHQRIHTGEKPYQCDECGRCFSQSSHLIQHQRTHTGEKPYQCSECGKCFSQSSHLRQHMKVHKEEKPRKTRGKNIRVKTHLPSWKAGTGRKSV
AGLR*
171 >lcl|XP_521492.2|Plus1complement(18167998..18168456) NW_003457573 protein atonal homolog 7 ATOH7 __SEG__ Chr10 {Pan troglodytes} MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVG
LHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT*
172 >lcl|XP_521719.2|Plus1complement(199391..199972) NW_003457667 achaete-scute homolog 2 ASCL2 __SEG__ Chr11 {Pan troglodytes} MDGGALPRSAPPAPRVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHD
AVRNALAGGLRPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY*
173 >lcl|XP_522250.1|Plus1complement(3270956..3271312) NW_003457709 transcription elongation factor B polypeptide 2-like LOC466850 __SEG__ Chr11 {Pan troglodytes} MDVFLVIRRRKTTIFTDAKESSTVLELKRVVEGILKRPPDEQRLYKDYQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDAFEALCIEPFSSPPELLDVMKPQESGS
SADEQAVQ*
174 >lcl|XP_522303.2|Plus1complement(4620761..4621306) NW_003457668 achaete-scute homolog 3 ASCL3 __SEG__ Chr11 {Pan troglodytes} MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPLLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGPAFIRKRNERERQRVKCVN
EGYAQLRHHLPEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKVETKNNPGKVSSMIATTSHHADPMFRIV*
175 >lcl|XP_522415.2|Plus1complement(12997263..12998258) NW_003457722 neurogenic differentiation factor 4 NEUROD4 __SEG__ Chr12 {Pan troglodytes} MSKTFVKSKEMGELVNTTSWMDKGLGSQNEVKEEESRPGTYGMLSSLTEEHDSIEEEEEEEEDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNL
RRVMPCYSKTQKLSKIETLRLARNYIWALSEVLETGQTPEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQSVLLEKHEDKSPICDSAISVHNFNYQSPGLPSPPYGHMETH
LLHLKPQVFKSLGESSFGSHLPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYSFMPHYPSSSLSSGHVHSTPFQAGTPRYDVPIDMSYDSYPHHGIGTQLNTVFT
E*
176 >lcl|XP_522519.3|Plus117897757..17898278 NW_003457733 achaete-scute homolog 4 ASCL4 __SEG__ Chr12 {Pan troglodytes} MMETRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGRQYLPVPLDSAFEPAFLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLS
KVKTLRAAIGYIKHLQELLERQARGVEGAAGAVPQRRAECNSDGESKASSAPSPSSEPEEGGS*
177 >lcl|XP_522825.2|Plus11011646..1013352 NW_003457847 insulinoma-associated protein 2 INSM2 __SEG__ Chr14 {Pan troglodytes} MPRGFLVKRTKRTGGSYRVRLAERVFPLLGPQGAPPFLEEAPSASLPGAERAAPPTREEPGKGLTAEAAREQSGSPCRAAGVSPGTGGREGAEWRAGGREGPGPSPSPSP
SPSPAKPAGAELRRAFLERCLSSPVSAESFPGGAAAVAAFSCSVAPAAAPTSGEQFLLPLRAPFPEPALQPDPAPLSAALQSLKRAAGGERRGKAPTGCASGPAAAGIKK
PKAMRKLSFADEVTTSPVLGLKIKEEEPGAPSRGLGGSRTPLGEFICQLCKEQYADPFALAQHRCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPRPAAANAATVSSA
DGKPPSSSSSSSRDSGAIASFLAEGKENSRIERTADQHPQARDSSGADQHPDSAPRQGLQVLTHPEPPLPQGPYTEGVLGRRVPVPGSTSGGRGSEIFVCPYCHKKFRRQ
AYLRKHLSTHEAGSARALAPGFGSERGAPLAFACPLCGAHFPTADIREKHRLWHAVREELLLPALAGAPPETSGPSGPSDGSAQQIFSCKHCPSTFFSSPGLTRHINKCH
PSESRQVLLLQMPLRPGC*
178 >lcl|XP_523524.3|Plus1201929..202636 NW_003458250 class A basic helix-loop-helix protein 9-like BHLHA9 __SEG__ Chr17 {Pan troglodytes} MLRGAPGLGLTARKGAEGSAEDLGGPCPEPGGDSGVLGANGASCSRGEAEEPAGRRRARPVRSKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRA
IHRIAALSLVLRASPAPRGPCGHLECHGPAARGDTGDTGASPPPPAGPSLARPDAARPTVPSAPRCASCPPNAPLARPSAVAEGPGLAQASGGSWRRCPGASSAGPPPWP
RGYLRSAPGMGHPRS*
179 >lcl|XP_523723.1|Plus1complement(1546325..1547380) NW_003458353 cyclic AMP-dependent transcription factor ATF-4-like isoform 2 ATF4 __SEG__ Chr17 {Pan troglodytes} MTEMSFLSNEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKRDAFSGTHWMLEKMDLEEFDFGALLGIDDLETMPD
DLLTTLDDTCNLFAPLVQETNKAPPQMVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVQSSTPDHSFSLELGSAVDITKGDRKPDSTAYVAMIPQCIKEEDTPSDNDSG
ICMSLESYLGSPQHSPSTRGSPNRSLPSPGVLCGSAHPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKE
IQYLKDLIEEVRKARGKKRVP*
180 >lcl|XP_523844.1|Plus1692661..694169 NW_003458253 zinc finger protein 3 homolog ZFP3 __SEG__ Chr17 {Pan troglodytes} MGTENKEVIPKEEISEESEPHGSLLEKFPKVVYQDHEFGAGCEEDMLEGHSRESMEEVIEQMSPQERDFPSGLMIFKKSPSSEKDRENNESERGCSPSPNLVTHQGDTTE
GVSAFATSGQNFLEILESNKTQRSSVGEKPHTCKECGKAFNQNSHLIQHMRVHSGEKPFECKECGKTFGTNSSLRRHLRIHAGEKPFACNECGKAFIQSSHLIHHHRIHT
GERPYKCEECGKAFSQNSALILHQRIHTGEKPYECNECGKTFRVSSQLIQHQRIHTEERYHECNECGKAFKHSSGLIRHQKIHTGEKPYLCNECGKGFGQSSELIRHQRI
HTGDKPYECNECGKTFGQNSEIIRHIRIHTGEKPYVCKECGKAFRGNSELLRHERIHTGEKPYECFECGKAFRRTSHLIVHQRIHTGEKPHQCNECARTFWDNSELLLHQ
KIHIGEKPYECSECEKTFSQHSQLIIHQRIHTGEKPYECQECQKTFSRSSHLLRHQSVHCME*
181 >lcl|XP_523920.3|Plus1complement(2573..5167) NW_003458390 RNA polymerase II transcription factor SIII subunit A2 TCEB3B __SEG__ Chr18 {Pan troglodytes} MGYTRPSSGTRASFFVAQQTAEVTPGCGSTSRGTKAGLLSCLQGRPFQTKWPAAPRTQLAPGCDSTSRGRCLATGQRGPATPDCLCRRPKDRAATAGTATPAQRRLHSSG
EMAAGSSTLRAVEKLQVRLATKTDPKKLEKYLQKLSALPMTADILAETGIRKTVKRLRKHQHVGDFARDLAARWKKLVLVDRNTGPDPQDPEEGASRQRFGEALQDREKA
WGFPEIGAAPRSPSDSPEHRPTAHRTLPGQQRPHPRSPSREPRAERKCPRIAPADSGRYRASPARTTPLPMPEGSEPAAPGKQPGRSHTHAAQGGHLLGPGCQGQPQGKA
VVSHSKGHKSSRQEKRPLCAQGDWHSPTLIREKSCRACLREETPRMPSWASARDRQPSDFKTDKEGGQAGSGQRVPALEEAPDSHQKRPQHRHSNKKRPSLDGRDPGNGT
HGLSPEEKEQLSNNRETQEGKPPTAHLDRTSVSSLSEVEEVDMAEEFEQPTLSCEKYLTYDQLRKQKKKTGKSSTTALGDKQRKANESKGTRESWDSAKKLPPVQESQSE
RLQAAGAHSAGPKTVPSHAFSELWDLSEAWMQANYDPLSDSDSMISQAKPEALSAPKFREEAAFPGRRVNAKMPVYSGSRPACQLQVPTLRQQCVQVLRNNPDALRDVGE
VPYWVLEPVLEGWRPDQLYRRKKDNHALVRETDELRRIHCFQDFKEEKPQENKTWREQYLRLRDAPEQRLRVMTTNIRSARGNNPNGREAKMICFKSVAKTPYDTSRRQE
KSAGDADPENGEIKPASKPAGSSHTPSSQSSSDGGRDSSSSVLRWLPEKRANPCLSSSNEHSAPAAKTRKQAAKKLAPLMAKAIRDYKRRFSRR*
182 >lcl|XP_524237.2|Plus11377947..1379185 NW_003458502 zinc finger protein 260 isoform 2 ZNF260 __SEG__ Chr19 {Pan troglodytes} MIGMLESLQHESDLLQHDQIHTGEKPYECNECRKTFSLKQNLVEHKKMHTGEKSHECTECGKVCSRVSSLTLHLRSHTGKKAYKCNKCGKAFSQKENFLSHQKHHTGEKP
YECEKVSIQMPTIIRHQKNHTGTKPYACKECGKAFNGKAYLTEHEKIHTGEKPFECNQCGRAFSQKQYLIKHQNIHTGKKPFKCSECGKAFSQKENLIIHQRIHTGEKPY
ECKGCGKAFIQKSSLIRHQRSHTGEKPYTCKECGKAFSGKSNLTEHEKIHIGEKPYKCNECGTIFRQKQYLIKHHNIHTGEKPYECNKCGKAFSRITSLIVHVRIHTGDK
PYECKVCGKAFCQSSSLTVHMRSHTGEKPYGCNECGKAFSQFSTLALHMRIHTGEKPYQCSECGKAFSQKSHHIRHQRIHTH*
183 >lcl|XP_525015.3|Plus1complement(3519468..3522158) NW_003456643 zinc finger protein 281 ZNF281 __SEG__ Chr1 {Pan troglodytes} MKIGSGFLSGGGGTGSSGGSGSGGGGSGGGGGSSSSGRRAEMEPTFPQGMVMFNHRLPPVTSFTRPAGSAAPPPQCVLSSSTSAAPAAEPPPPPAPDMTFKKEPAASAAA
FPSQRTSWGFLQSLVSIKQEKPADPEEQQSHHHHHHHHHYGGLFAGAEERSPGLEGGEGGSHGVIQDLSILHQHVQQQPAQHHRDVLLSSSSRTDDHHGTEEPKQDTNVK
KAKRPKPESQGIKAKRKPSASSKPSLVGDGEGAILSPSQKPHICDHCSAAFRSSYHLRRHVLIHTGERPFQCSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQK
YHMERHKRTHSGEKPYKCDTCQQYFSRTDRLLKHRRTCGEVIVKGATSAEPGSSNHNNMGNLAVLSQGNTSSSRRKTKSKSIAIENKEQKTGKTNESQISNNINMQSYSV
EMPTVSSSGGIIGTGIDELQKRVPKLIFKKGSRKNTDKNYLNFVSPLPDIVGQKSLSGKPSGSLGIVSNNSVETIGLLQSTSGKQGQISSNYDDAMQFSKKRRYLPTASS
NSAFSINVGHMVSQQSVIQSAGVSVLDNEAPLSLIDSSALNAEIKSCHDKSGIPDEVLQSILDQYSNKSESQKEDPFNIAEPRVDLHTSGEHSELVQEENLSPGTQTPSN
DKASMLQEYSKYLQQAFEKSTNASFTLGHGFQFVSLSSPLHNHTLFPEKQIYTTSPLECGFGQSVTSVLPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLI
DSQKNLETSSAFQSSSQKLTSQKEQKNLESSTGFQIPSQELASQIDPQKDIEPRTTYQIENFAQAFGSQFKSGSRVPMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVS
EPCSTRVKTPTSQSYR*
184 >lcl|XP_525325.3|Plus1complement(2378710..2379681) NW_003458556 transcription factor MafB MAFB __SEG__ Chr20 {Pan troglodytes} MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEA
LIGSHPVPQPLQSFDSFRGAHHHHHHHHPHPHHAYPGAGVAHDELGPHAHPHHHHHHQASPPPSSAASPAQQLPTSHPGPGPHATAAATAAGGNGSVEDRFSDDQLVSMS
VRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL*
185 >lcl|XP_525353.2|Plus11377468..1378505 NW_003458557 CCAAT/enhancer-binding protein beta CEBPB __SEG__ Chr20 {Pan troglodytes} MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPAS
SGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGS
SGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNL
FKQLPEPLLASSGHC*
186 >lcl|XP_525382.3|Plus1complement(389330..390055) NW_003458576 class E basic helix-loop-helix protein 23 BHLHE23 __SEG__ Chr20 {Pan troglodytes} MSIRPPGEPPSPGGTAMAELKSLSGDAYLALSHGYAAAAAGLAYGAAREPEAARGYGTPGPGGDLPAAPAPRAPAQAAESSGEQSGDEDDAFEQRRRRRGPGSAADGRRR
PREQRSLRLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALDEMRRLVAFLNQGQGLAAPVNAAPLTPFGQATVCPFSAGAALGPCP
DKCAAFSGTPSALCKHCHEKP*
187 >lcl|XP_525646.1|Plus1complement(47432..48772) NW_003458643 zinc finger protein 70 ZNF70 __SEG__ Chr22 {Pan troglodytes} MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEEHDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSE
EPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSALTQHQKIHTG
KRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTH
TGEKPYKCQKCGKAFSQSSSLIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKI
HSGEKL*
188 >lcl|XP_525696.1|Plus11675860..1676441 NW_003456688 mesogenin-1 MSGN1 __SEG__ Chr2A {Pan troglodytes} MDNLRETFLSLEDGLGSSDSPGLLSSWDWKDRAGPFELNQASPSQSLSPAPSLESYSSSPCPAVAGLPCEHGGASSGGSDGCSVGGASGLVEVDYNMLAFQPTYLQGGGG
PKAQKGTKVRMSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTDLLNRGREPRAQSA*
189 >lcl|XP_526190.3|Plus150869..51684 NW_003456877 zinc finger protein 501 ZNF501 __SEG__ Chr3 {Pan troglodytes} MNSSQISLRMKHGRVNMQKKPSKCSECGKFFTQRSSLTQHQRIHRGEKPYVCSECGSCFRKQSNLTQHLRIHTGEKPYKCNECEKAFQTKAILVQHLRIHTGEKPYKCNE
CGKAFCQSPSLIKHQRIHTGEKPYKCTECGKAFSQSVCLTRHQRSHSGDKPFKCNECGKAFNQSACLMQHQRIHSGEKPYTCTECGKAFTQNSSLVEHERTHTGEKLYKC
SECEKTFRKQAHLSEHYRIHTGEKPYECVGCGKSFRHSSALLRHQRLHAGE*
190 >lcl|XP_526317.2|Plus16601420..6602142 NW_003456893 transcription factor SOX-14 SOX14 __SEG__ Chr3 {Pan troglodytes} MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGL
PVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSASTLQPPVAYIL
FPGMTKTGIDPYSSAHATAM*
191 >lcl|XP_526323.2|Plus1complement(7797796..7798920) NW_003456893 forkhead box protein L2 FOXL2 __SEG__ Chr3 {Pan troglodytes} MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGGGGGGGTAPEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNE
CFIKVPREGGGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAHFQPGKGLFGAGGAAGGCGVAGAAADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMPYASCQM
AAAAAAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGPYTRVQSMALPPGVVNSYNGLGGPPAAPPPPPHPHPHAHHLHAAAAPPPAPPHHGAAAPPPGQLSPASPATAAP
PAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLDL*
192 >lcl|XP_526841.1|Plus19866039..9866590 NW_003457013 putative TAF11-like protein ENSP00000332601-like LOC471463 __SEG__ Chr5 {Pan troglodytes} MPRGLKGSNKDGIPEDLDGNLEEPRDQEGELRSEDVMDLTEGDKETSASAPPAAKRLKTDTKGKKERKPTVDAEEAQRMTTLLSAMSEEQLARYEVCRQSAFPKARIAAL
MQSITGSSVSENATIAMAGIAKVLVGEVVEEALDVCEMWGETPPLQPKHLREAVRRLKPKGLFPNSNYKKIMF*
193 >lcl|XP_526843.2|Plus19878070..9878621 NW_003457013 putative TAF11-like protein ENSP00000332601-like LOC471465 __SEG__ Chr5 {Pan troglodytes} MPRDLKGSKKDGIPEDLDGNLEEPRDQEGELRSEDVMDLPEGDNEASASAPPAVKRRKTHTKGKKERKPTVDAEEAQRMTTLLSAMSEEQLSRYEMCRRSAFPRARIAGL
MRAIIGSSVSENAAIAMAGIAKVFVGEVVEEALDVCEMWGETPPLQPKHLREAVRRLKPKGLFPNSNCKKIMF*
194 >lcl|XP_527027.1|Plus1661731..662699 NW_003457059 transcriptional activator protein Pur-alpha isoform 3 PURA __SEG__ Chr5 {Pan troglodytes} MADRDSGSEQGGAALGSGGSLGHPGSGSGSGGGGGGGGGGGGSGGGGGGAPGGLQHETQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEF
RDYLGDFIEHYAQLGPSQPPDLAQAQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPE
GTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEMKKIQEKQREKRAACEQLHQQQQQQQEETAAATLLLQGEEEGEED*
195 >lcl|XP_527047.1|Plus1complement(1894869..1895918) NW_003457059 transcription initiation factor TFIID subunit 7 isoform 2 TAF7 __SEG__ Chr5 {Pan troglodytes} MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEP
VASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELR
EIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKED
REKEQLSSLQEELESLLEK*
196 >lcl|XP_527188.2|Plus181425..82021 NW_003457014 putative TAF11-like protein ENSP00000332601-like LOC471810 __SEG__ Chr5 {Pan troglodytes} METGRQTGVSAEMLAMPRGLKGSKKDGIPEELDGNSEEPRDQEGELRSEDVMDLPEGDNEASASAPPAAKRRKTHTKGKKERKPTVDAEEAQRMTTLLSAMSEEQLSRYE
VCRRSAFPRARIAGLMRAITGSSVSENAAIAMAGIAKVFVGEVVEEALDVCEMWGETPPLQPKHLREAVRRLKPKGLFPNSNCKRIMF*
197 >lcl|XP_527244.1|Plus118023306..18024730 NW_003457102 transcription factor SOX-4 SOX4 __SEG__ Chr6 {Pan troglodytes} MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIR
EAERLRLKHMADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGGSGGGGHGGGGGGGSSNAGGGGGGASGGGANSKPAQKKSCGSKVAGGAGGGVSKPHAKLIL
AGGGGGGKAAAAAAASFAAEQAGAAALLPLGAAADHHSLYKARTPSASASASSAASASAALAAPGKHLAEKKVKRVYLFGGLGTSSSPVGGVGAGADPSDPLGLYEEEGA
GCSPDAPSLSGRSSAASSPAAGRSPADHRGYASLRAASPAPSSAPSHASSSASSHSSSSSSSGSSSSDDEFEDDLLDLNPSSNFESMSLGSFSSSSALDRDLDFNFEPGS
GSHFEFPDYCTPEVSEMISGDWLESSISNLVFTY*
198 >lcl|XP_527245.2|Plus119011729..19012478 NW_003457102 hepatoma derived growth factor-like 1 HDGFL1 __SEG__ Chr6 {Pan troglodytes} MSDYSMPTYKSGDLVFAKLKGYAHWPARIEDMTQPNRYQVFFFGTHETAFLSPKRLFPYKECKEKFGKPNKRRGFSEGLWEIENNPTVQASDCPLASEKGSGDGPWPEPE
AAEGDEDKPTHAGGGGDELGKPDDDKPTEEEKGPLKRSAGDPPEDAPKRPKKAAPDQEEKEEAEAERAAAAMAAAAAAVDEECPFLVAVENGSAPSEPGLACEPPQPEEE
ELREEEVADEEASQEWHAEAPGGGDRDSL*
199 >lcl|XP_527513.2|Plus1complement(31812476..31813294) NW_003457154 oligodendrocyte transcription factor 3 OLIG3 __SEG__ Chr6 {Pan troglodytes} MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQKTPGESLSRAGAKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVM
PYAHGPSVRKLSKIATLLLARNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANTVHPVHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPS
TPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK*
200 >lcl|XP_527605.3|Plus1435629..436705 NW_003457108 zinc finger protein 391 ZNF391 __SEG__ Chr6 {Pan troglodytes} MESLRGNTAQGPTNEEDYKNEGQLSRQTKCPAQKKSSFENTVVRKVSVTLKEIFTGEEGPESSEFSLSPNLDAQQKIPKGDGSPISRKNSKDNSDLIKHQRLFSQRKPCK
CNECEKAFSYQSDLLVHSRIHGGEKPFECNKCGKSFSRSTHLIEHQRTHTGEKPYECNECGKAFSRSTHLSLHQRIHTGEKPYECSECGKAFSRSTNLSQHQQTHTQERP
YKCNECGKAFGDRSTIIQHQRIHTGENPYECSKCGKAFTWISSLIEHQRTHTGENPYECSECGKVFSRSSSLTEHQRIHSGEKPHECRVCGKGFSRGSSLIIHQRTHTGE
KPYKCNDCGKAFCQSSTLIRHQHLHTKE*
201 >lcl|XP_527676.1|Plus115916166..15916666 NW_003457175 fer3-like protein FERD3L __SEG__ Chr7 {Pan troglodytes} MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEGDPEEEECEVDQGDGEEEEEEERGRGVSLLGRPKRKRVITYAQRQAANIRE
RKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLESCEKKESG*
202 >lcl|XP_527829.1|Plus126755537..26756106 NW_003457184 class A basic helix-loop-helix protein 15 BHLHA15 __SEG__ Chr7 {Pan troglodytes} MKTKNRPPRRRAPVQDTEATPGEGTPDGSLPNPGPEPAKGLRSRPARAAAGAPGEGRRRRPGPSGPGGRRDSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKK
LSKIETLTLAKNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYSTQIHSFREGT*
203 >lcl|XP_527875.2|Plus111718057..11718641 NW_003457186 putative RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like protein 3-like LOC472500 __SEG__ Chr7 {Pan troglodytes} MLSSPLRVAVVCVSNINRSMEAHSILRRKGLSVRSFGTESHVRLPGRRRNHPVVYDFATTYKEMYNDLLRKDRECYTHNGILHILGRNERIKPGPERFQECTEFFDVIFT
CEERVYDTVMEDLCSREQQTFQPVHVINMDIEDTLEGATLGAFLICEICQCLQQSDDMEDSLEELLLQMEEKAGKSFLHTVCFY*
204 >lcl|XP_528103.1|Plus1complement(7847544..7848587) NW_003457217 purine-rich element-binding protein gamma isoform 2 PURG __SEG__ Chr8 {Pan troglodytes} MERARRRGGGGGRGRGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLS
VAAELKDCLGDFIEHYAHLGLKGHRQEHGHSKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHSLGQEQ
TIVLPAQGMIEFRDALVQLIEDYGEGDIEERRGGDDDPLELPEGTSFRVDNKRFYFDVGSNKYGIFLKVSEVRPPYRNTITVPFKAWTRFGENFIKYEEEMRKICNSHKE
KRMDGRKASGEEQECLD*
205 >lcl|XP_528230.1|Plus16537549..6538628 NW_003457247 putative POU domain, class 5, transcription factor 1B POU5F1B __SEG__ Chr8 {Pan troglodytes} MAGHLASDFAFSPPPGGEGDGPGGPEPGWVDPLTWLRFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGAGLVPQGGLETSQPEGEAGVGVESNSDGA
SPEPCTVPPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLILGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEETDNNENLQEI
CKAETLMQARKRKRTSIENRVRGNLENLFLQCPKPTLQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYEQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFT
ALYSSVPFPEGEVFPPVSVITLGSPMHLN*
206 >lcl|XP_528330.2|Plus18767914..8769212 NW_003457452 forkhead box protein B2 FOXB2 __SEG__ Chr9 {Pan troglodytes} MPRPGKSSYSDQKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPDCGDMFENGSFLRRRKRFK
VLRADHTHLHAGSTKGAPGAGPGGHLHPHHHHHPHHHHHHHAAAHHHHHHHPPQPPPPPPPPPPHMVHYFHQQPPTAPQPPPHLPSQPPQQPPQQSQPQQPSHPGKMQEA
AAVAAAAAAAAAAAVGSVGRLSHVPPYGLGSAAAAAAAAAASTSGFKHPFAIENIIGRDYKGVLQAGGLPLASVMHHLGYPVPGQLGNVVSSVWPHVGVMDSVAAAAAAA
AAAGVPVGPEYGAFGVPVKSLCHSASQSLPAMPVPIKPTPALPPVSALQPGLTVPAASQQPPAPSTVCSAAAASPVASLLEPTAPTAAESKGGSLHSVLVHS*
207 >lcl|XP_528380.2|Plus1451219..451545 NW_003457475 t-cell acute lymphocytic leukemia protein 2 TAL2 __SEG__ Chr9 {Pan troglodytes} MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP*
208 >lcl|XP_528965.3|Plus1complement(261352..263022) NW_003458872 zinc finger protein 182 ZNF182 __SEG__ ChrX {Pan troglodytes} MSKRKGGLLYFFLEVCQVDEQIERQHQDDQDKCLLMQVGFSDKKTIITKSARDCHEFGNILHLSTNLVASIQRPDKHESFGNNMVDNLDLFSRSSAENKYDNGCAKLFFH
TEYEKTNPGMKPYGYKECGKGLRRKKGLSLHQRIKNGEKPFECTACRKTFSKKSHLIVHWRTHTGEKPFGCTECGKAFSQKSQLIIHLRTHTGERPFECPECGKAFREKS
TVIIHYRTHTGEKPYECNECGKAFTQKSNLIVHQKTHTGEKTYECTKCGESFIQKLDLIIHHSTHTGKKPHECNECKKTFSDKSTLIIHQRTHTGEKPHKCTECGKSFNE
KSTLIVHQRTHTGEKPYECDVCGKTFTQKSNLGVHQRTHSGEKPFECNECEKAFSQKSYLMLHQRGHTGEKPYECNECEKAFSQKSYLIIHQRTHTEEKPYKCNECGKAF
REKSKLIIHQRIHTGEKPYECPVCWKAFSQKSQLIIHQRTHTGEKPYACTECGKAFREKSTFTVHQRTHTGEKPYKCTECGKAFTQKSNLIVHQRTHAGKKAHGRGHTRK
SKFMAH*
209 >lcl|XP_529000.1|Plus1133911..134846 NW_003458983 forkhead box protein R2 FOXR2 __SEG__ ChrX {Pan troglodytes} MDLKLKDCEFWYSLHGQVPGMLDWDMRNELFLPCTTDQCSLAEQILAKYRVGVMKPPEMPQKRISSPDGDGPPCEPNLWMWVNPNIVCPLGSQEAPKPSGKEDLTNISPF
PQPPQKDEGSNCSEDKVVESLPSSSSEQFPLQKQGIHSPSDFELTEEEAEEQDDNSLQSPEMKCFQSQKLWQIDSQQKSWQRPPLNCSHLIALALRNNPHCGLSVQEIYN
FTRQHFPFFWTAPDGWKSTIHYNLCFLDSFEKVPDSLKDEDNARPRSCLWKLTKEGHRRFWEETRALAFAQRERIQECMSQPELLTSLFDL*
210 >lcl|XP_529111.1|Plus161455..62039 NW_003459142 RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like LOC473738 __SEG__ ChrX {Pan troglodytes} MSLSPLRVAVVCWNNQNQSMEAQRVLNRRGFSVQSFGITPHVKLPGPAPNKPNIYDFKTTYDEMYNDLITKDKQFYTQNGVLYMLDRNKRIKLRPERFQDCKDVFDLIIT
CEERIYDQVVEDLNSREQETCQPVHVVNMDIRDNQEDAITGAFLICELCQCIQRSEDMENEIDQLLQKLEKKRGQAFLHTVCFY*
211 >lcl|XP_529189.3|Plus1256..906 NW_003459255 heat shock transcription factor, X-linked-like HSFX1 __SEG__ ChrX {Pan troglodytes} MKRRVGVKSAPRHQEEDKPEAAGSCLAPADTEQQDHTSPNENDQVTPQHREPAGPNTQIRSGSAPPATPVMVPDSAVASDNSPVTQPAGEWSEGSQAHVTPVATVPGPAA
LPFLYVPGSPTQMNSYGPVVALPTASRSTLAMDTTGLPAPGMLPFCHLWVPVTLVAAGAAQPAASMVMFPHLPALHHHCPHSHRTSQYMPASDEPQVYPDYADQST*
212 >lcl|XP_529235.2|Plus13631832..3632950 NW_003458802 transcription factor YY2 YY2 __SEG__ ChrX {Pan troglodytes} MASNEDFSITQDLEIPSDIVELHDINVEPLPMEDIPMESVQYEDVDGNWIYGGHSHPPLMVLQPLFTNTGYGDHDQEMLMLQTQEEVVGYCDSDNQLGNDLEDQLALPDS
IEDEHFQMTLASLSASAASTSTSTQSRSKKPSKKPSGKSATSTEANPAGSSSSEGTRKWEQKQMQVKTLEGEFSVTMWSPNDNNDQGAVGEGQAENPPDYSEYLKGKKLP
PGGLPGVDLSDPKQLAEFTKVKPKRSKGEPPKTVACSYSGCEKMFRDYAAMRKHLHIHGPRVHVCTECGKAFLESSKLRRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRT
HLRIHTGDKPFVCPFDVCNRKFAQSTNLKTHILTHVKTKNNP*
213 >lcl|XP_529689.2|Plus115280893..15281870 NW_003457950 forkhead box protein B1 FOXB1 __SEG__ Chr15 {Pan troglodytes} MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK
VLKSDHLAPSKPADAAQYLQQQAKLRLSALAASGTHLPQMPAAAYNLGGVAQPSGFKHPFAIENIIAREYKMPGGLAFSAMQPVPAAYPLPNQLTTMGSSLGTGWPHVYG
SAGMIDSATPISMASGDYSAYGVPLKPLCHAAGQTLPAIPVPIKPTPAAVPALPALPAPIPTLLSNSPPSLSPTSSQTATSQSSPATPSETLTSPASALHSVAVH*
214 >lcl|XP_530336.2|Plus119173394..19174221 NT_106996 oligodendrocyte transcription factor 1 OLIG1 __SEG__ Chr21 {Pan troglodytes} MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSSTSSTSSSSTTAPLLPKAAREKPEAPAEPAGPGPGSGAHPGGSARPDAKEEQQQLL
RRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRP
AKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK*