SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus K    

ID / Description / Sequence
1 >lcl|NP_001007578.2|Plus1complement(25356179..25357258) NT_039718 transcription elongation factor A N-terminal and central domain-containing protein Tceanc __SEG__ ChrX {Mus musculus} MSDKNQIIARASLIEQLVSKRYFEDIGKQLTELEMIYVSKEHLQETDVVRAVYRVLKNCPSVTLKKKAKCLLAKWRGFYKSTHCKPRQSPKVLHTNANKEESAAVSQDVS
QDETSGSSHSEIMGLCSSLSRLLPQDAAKPAAAIGSESSTAQMEINEGYLKGDDSECTRKSSGVFQGTLVSVRSKCVELLYTALASSCTDHTEVHIWQNLAREIEEHIFT
LHSNNIKKYKTSIRSKVANLKNPRNFHLQQNFLSGTMSAREFAEMSVLDMASQELKQLRASYTESSIQEHCLPQSVDGTWTNKIKCRRCDKYNCKVTVIARGTLFLPSWV
QNSNPDEQMTYVICNECGEQWYHNNWVCL*
2 >lcl|NP_001020017.1|Plus114533464..14536187 NT_096135 zinc finger protein 62 isoform 2 Zfp62 __SEG__ Chr11 {Mus musculus} MEDEESSKKNENDSNADSQCPSVGFFHKDHMQKSKTGDTCDLFPKWKILKEGKSSIREMIDTHTNAANIKLEQDDETSEKSFYPSTNTMHQTIPTEPNCTKQGEHTENIN
GNVHPAHIADKKLHKCDECGKSFKYNSRLVQHKIMHTGEKRYECDDCRGTFRSSSSLRVHKRIHTGEKPYKCDECGKAYMSYSSLINHKSTHSGEKNCKCDECGKSFNYS
SVLDQHKRIHTGEKPYECGECGKAFRNSSGLRVHKRIHTGEKPYECDTCGKTFSNSSGLRVHKRIHTGEKPYECDECGKAFITCRTLLNHKSIHFGDKPYKCDECEKSFN
YSSLLIQHKVIHTGEKPYECDECGKAFRNSSGLIVHKRIHTGEKPYKCDICGKAFSYSSGLAVHKSIHPGKKAHECKDCGKSFSYNSLLLQHKTIHTGERPYVCDVCGKT
FRNNSGLKVHRRLHTGEKPYKCDVCGKAYISRSSLKNHKGIHMGEKPYKCSYCEKSFNYSSALEQHKRIHTREKPFGCDECGKAFRNNSGLKVHKRIHTGERPYKCEECG
KAYISLSSLINHKSVHPGEKPFKCDECEKAFITYRTLLNHKKIHLGEKPYKCDVCEKSFNYTSLLSQHKRVHTREKPFECDRCEKVFRNNSSLKVHKRIHTGEKPYECDI
CGKAYISHSSLINHKSTHPGKTSYTCDECGKAFFSSRTLISHKRVHLGEKPFKCVECGKSFSYSSLLSQHKRIHTGEKPYVCDWCGKAFRNSSGLTVHKRIHTGEKPYGC
DECEKAYISHSSLINHKSVHRGKQPYNCECGKSFNYRSVLDQHKRIHTGKKPYRCNDCGKAFNIRSNLTKHKRIHTGEESLNMANMESHSGTFQKMIYYEGGNSLDGTRM
QMPVWEAEHAKSQRNQIEEKLYEYNNF*
3 >lcl|NP_001020748.2|Plus1complement(43063005..43064117) NT_078575 transcription factor Maf Maf __SEG__ Chr8 {Mus musculus} MASELAMNNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPMSTPCSSVPPSPSFSAPSPGSGSEQKAHLEDYYWMTGYPQQLNPEALGFSP
EDAVEALISNSHQLQGGFDGYARGAQQLAAAAGAGAGASLGGSGEEMGPAAAVVSAVIAAAAAQSGAAPHYHHHHHHAAGHHHHPTAGAPGAAGGASASASGAGGAGGGG
PASAGGGGGGGGGGGTAGAGGALHPHHAAGGLHFDDRFSDEQLVTMSVRELNRQLRGVSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHVLESEKNQLLQQVDHLKQE
ISRLVRERDAYKEKYEKLVSNGFRENGSSSDNPSSPEFFM*
4 >lcl|NP_001028369.1|Plus170967562..70968881 NT_039207 hypothetical protein LOC99169 AU015228 __SEG__ Chr2 {Mus musculus} MADPDVLTEVPAALKRLAKYVVRGFYGIEHVLALDILIRNPCVKEEDMLELLKFDRKQLRSVLNTLKGDKFVKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHM
RRRIEMDERNSTSRASFKCPVCCSTFTDLDANRLFEPTIGTFCCTFCHTEVEENEPAMPKKDARVLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTAIPALKLSKDR
AATASGAAGLAGGCHREAQTNKAPSYEDLYTQNVVINMDDQDVMHRTSLEGKAAKQRPVWLRESTVPGAYSSEEMKEGGMDVDTVQEHKQAHAGPDDNEAVMRVLRIHEK
KTSSATTAGSVGAEALARAANNSDSESETSESDDGFPPRPAAAAPPHHHEDEEDEELEEVAGDPIVMVAGCPFSFSEVSQRPELVAQMTPEEKEAYIAISQRVFRDLFE*
5 >lcl|NP_001028387.1|Plus1complement(52047505..52049208) NT_039606 hypothetical protein LOC105590 AU017455 __SEG__ Chr14 {Mus musculus} MNKQKKQKQQPPPPPQPPQIPESSADEEPKPKKRRQRRERRKPGARPRKRKTKQAVPIVDPQEPEIKLKYATQPLGKTNAKTKSFPPYIHAVNKGELGAVCTIVNAEEDE
EQIKLVRSRKGQRSLTPPYSNTGSKVLPASSFMLQGPVVTESSVVEPVVCCLCGKGAGYGNMGDLFGPFYPQNYPATLPKNPPPKRSTEMQSKVKVRHKSASKGSKTDTE
EEEQQQQQKEQRSPAAHPRFNLRQRSKDSAGGPRSLSRGRPRKNVASKGNSKETVLDTKPSVPASSKGGPERGGGPRSLSRGRPRKNVASKGNSKETVLDTKPSVPTTSK
GGPEREWSSPERGGGPRSLSRGRPRKNAAAKGSSKKTVLDTKLSVPTTSKGTNSSKTDTQEQQQQKEQRSLAAHPRFNLRQRSKDSAGGPRSLSRGRPRKNVAPKGNSKE
TVLDTKPSVPTTSKGGPEWELQIPERPLPSNEFWVHEDCILWANGTYLVYGRLYGLLEALENARDVTCSHCQKAGATLGCYNKGCTFRYHYPCAIDADCLLNEENFSVRC
PKHKVRLQRREGGDGQT*
6 >lcl|NP_001028555.1|Plus11980620..1983796 NT_039413 zinc finger protein 865 Zfp865 __SEG__ Chr7 {Mus musculus} MEANQAGSGAGGGGSSGIGGEDGVHFQSYPFDFLEFLNHQRFEPMELYGEHAKAVAALPCTPGPPPQPPPQPPPPQYDYPPQSSFKPKAEAPSSSSSSSSSSSSSSSSSS
SSSQAKKMDPPLPPTFGAPPPPLFDAAFPAPQWGIVDLSGHQHLFGNLKRGGPTPGPGVASGLGTPTGTPGPLTTPSQTPPGPAVGAACDPTKDDKGYFRRLKYLMERRF
PCGVCQKSFKQSSHLVQHMLVHSGERPYECGICGRTYNHVSSLIRHRRCHKDVPPTPTGGTPQPGPALPSLGLPVSTASATASSDPAAVSSGPSATPATPATSTDGNTTP
AAPPGVAMPPSATTGGDGPFACSLCWKVFKKPSHLHQHQIIHTGEKPFSCSVCSKSFNRRESLKRHVKTHSADLLRLPCGICGKVFRDASYLLKHQAAHAAAGTPRPVYP
CDLCGKTYSAPQSLLRHKAAHAPPVATEPAKDGAASVPQPPPPFPPGPYLLPADPSTTDEKATAAAAAVVYGAVPVPLLSAHPLLLGGAGNGGAGGPGAGGPSKTFCCGI
CGRAFGRRETLKRHERIHTGEKPHQCPVCGKRFRESFHLSKHHVVHTRERPYKCELCGKVFGYPQSLTRHRQVHRLQLPCALAGATGLATGQGTTGACGPGAAGTSGGPA
DLSYACSDCGEHFPDLFHVMSHKEAHMSEKPYGCDACGKTFGFIENLMWHKLVHQAAPERLLAPTPSGPQSSDGGSSGGGTDASSVLDNGLAGEVGTAVAALAGVSGGSE
DAGGATVAGSGGGTSSGAERFSCATCGQSFKHFLGLVTHKYVHLVRRTLGCGLCGQSFAGAYDLLLHRRSHRQKRGFRCPVCGKRFWEAALLMRHQRCHTEQRPYRCGVC
GRGFLRSWYLRQHRVVHTGERAFKCGVCAKHFAQSSSLAEHRRLHAVARPQRCGACGKTFRYRSNLLEHQRLHLGERAYRCEHCGKGFFYLSSVLRHQRAHEPPRPELRC
PACLKAFKDPGYFRKHLAAHQGGRPFRCSSCGEGFANTYGLKKHRLMHKAEGLGMPGTGGSALAGKDP*
7 >lcl|NP_001030041.1|Plus1complement(29650..30525) NT_039500 hypothetical protein LOC245263 Gm4981 __SEG__ Chr10 {Mus musculus} MRSSSRRPHTGLTLSQRRILAQAFERNPRPGCATREELALETGLPEDMIHTWLKNKRARRHRRGRPTAQDQDLLASQVSGGAPAGPVGRGHEVAQESSLPQEEAGSTGMD
TTSTSYSPSFCRESQLSQVSQPRGAGQKEVPTQAGNVGPLELLLDELQDEVQVKEHVPDPLDLGSDPGAREPEGSQDSLQSLDEAANSGWHTSVPSISSTLCRESQPSQV
AQPSGPGQAQAPTQSGFIDPLELFLDELLTEVQLEEQGPAPVNVEETGEQMDTTPELPLTPEEYQTLLDML*
8 >lcl|NP_001030066.1|Plus111980607..11981515 NT_039718 forkhead box protein R2 Foxr2 __SEG__ ChrX {Mus musculus} MDVKVKNRDFWYSLHGQVPGMLDWDMGNEFFLPCTMDQCSFAEQSLAKYKIQLTKPPALPQKKKSNFDDDGPPAEPSLWMWVNPNIVCPINSKEAPNTIHKILPSAPFPQ
TGESDYLGTQRMVQSLSVLHTEHHQQQKLLIYSTAPDFIEEETKEQECTSSKKYSKKHTVCHGPHREKESWPRPPLNYSHLVALALKSSPSCGLNVQQIYNFTRQHFPYF
RTAPEGWKNTIRHNLCSLTCFEKVPVDLEDEPDGKPRSFLWKLTDEGNRFFQEDTRVLAYARRESIKQSMRQPELIDLLFHL*
9 >lcl|NP_001036135.2|Plus11196361..1197506 NT_039299 mitochondrial transcription termination factor-like precursor Gm9897 __SEG__ Chr5 {Mus musculus} MIMASRNIWCVRRNFLFDLRGWMLQYSAEVFLKSISFRTFSVECDSKDKESLEEEREDLLSNLVTMGVDIDMARRRQPGVFNKAVTNEQELKIFLLSKGASDKVIGSIIS
RYPRAITRTPESLSKRWDLWRKIMASDLEIVNILERSPESFFRSNNNLNLENNIKFLCSVGLTHKCLCRLLTNAPRTFSNSLNLNKQMVEFLQETGMSLGHNDPRDFVRK
IISKNPSILIQSTKRVKTNIEFLQSTFNLNKQDLLLLICGPGARILDLSNDCTKKNYTNIRERLLSLGCSEEEVQRFVLSYLNMVFLSEKKFNDKIDCLIEEKISASQII
ENPRILDSSINTLKTRIRELSHAGYDLSTSSIALLSWSQRRYEAKLKRLCG*
10 >lcl|NP_001038162.1|Plus1complement(16218215..16219594) NT_096135 zinc finger protein 2 Zfp2 __SEG__ Chr11 {Mus musculus} MDREDLWHSALGAVWDPTCWLKGQQERYLGQVTVAQKEIYNEKSVCGGNTTENSSTEGSMLNTPQSIPVTPCNWNSYRKDSKQNSELMKTSRMFVQKKVYGCDECGKTFR
QSSSLLKHQRIHTGEKPYTCNVCDKHFIERSSLTVHQRTHTGEKPYKCHECGKAFSQSMNLTVHQRTHTGEKPYQCKECGKAFRKNSSLIQHERIHTGEKPYKCHDCGKA
FTQSMNLTVHQRTHTGEKPYECNQCGKAFSQSMHLIVHQRSHTGEKPYECSECGKAFSKSSTLTLHQRNHTGEKPYKCNKCGKSFSQSTYLIEHQRLHSGVKPFECNQCG
KAFSKNSSLTQHRRIHTGEKPYECMICGKHFTGRSSLTVHQVIHTGEKPYECTECGKAFSQSAYLIEHQRIHTGEKPYECDQCGKAFIKNSSLIVHQRIHTGEKPYQCNE
CGKSFSRSTNLTRHQRTHT*
11 >lcl|NP_001038183.1|Plus136734635..36735231 NT_039621 zinc finger protein 41 Zfp41 __SEG__ Chr15 {Mus musculus} MEKPATRKKKSQAPKEEAGAQKATVKGEKTSKGKKATKKPRKPRRPRKEPVLSPEDEAHIFDAFDASFKDDFEGVPVFVPFQRKKPYECGECGRIFKHKTDHIRHQRVHT
GEKPFKCDQCGKTFRHSSDVTKHQRIHTGEKPFKCGECGKAFNCGSNLLKHQKTHTGEKPYGCEECGKSFAYSSCLIRHRKRHPRKKH*
12 >lcl|NP_001073370.1|Plus1859268..860905 NT_039353 replication initiator 1 Repin1 __SEG__ Chr6 {Mus musculus} MLEQRCRGPTAMGPAQPWLFSGPSQESSQPDRGLRYQGKSAQPRGQTPGKVHRCAHCRKRFPGWVALWLHARRCQARLPLPCHECNQRFRHAPFLALHLQVHASAVPDLG
FICHLCGHSFRGWVALVLHLRAHSASKRPITCPECDRRFWRQKQLRAHLRRCQPPVPEARPFICGNCGRSFAQWDQLVVHKRVHVAEALEEAAAKALGPRPRGRPAAPRP
GGDAVDRPFQCACCGKRFRHKPNLIAHRRVHTGERPHQCPECGKRFTNKPYLTSHRRIHTGEKPYPCTECGRRFRHKPNLLSHSKIHKRLEVSAQAAPHPESHQIAAEPM
AQPALGVPLGSPRTPAEAPALLHSCSDCGRSFRLERFLRLHQRQHTGERPFACTECGKNFGKKTHLVAHSRVHSGERPFACEECGRRFSQGSHLAAHRRDHAPERPFVCP
DCGKAFRHKPYLAAHRRIHTGEKPYVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTFDDEDRLLMHQKKHDA*
13 >lcl|NP_001075219.1|Plus1175575..176360 NT_039313 zinc finger protein 664 Zfp664 __SEG__ Chr5 {Mus musculus} MIYKCPMCREFFSERADLFMHQKIHTAEKPHKCDKCDKGFFHISELHIHWRDHTGEKVYKCDDCGKDFSTTTKLNRHKKIHTVEKPYKCYECGKAFNWSSHLQIHMRVHT
GEKPYVCSECGRGFSNSSNLCMHQRVHTGEKPFKCEECGKAFRHTSSLCMHQRVHTGEKPYKCYECGKAFSQSSSLCIHQRVHTGEKPYRCCGCGKAFSQSSSLCIHQRV
HTGEKPFKCDECGKAFSQSTSLCIHQRVHTKERNHLKISVI*
14 >lcl|NP_001092193.1|Plus1complement(16421493..16422629) NT_039718 transcription factor YY2 Yy2 __SEG__ ChrX {Mus musculus} MASETEKLLCLNTESAEIPADFVELLPPDNIGDIEAVSLETSVGQTIEVYGDVGVDWAHGSQYHSPVIALQPLVGSSLSSRDHDKEMFVVQTREEEVVGYQDSDNLLFSP
EFGSQMVLPVNEDDYLQPTTASFTGFLAAENGQGELSPYEGNLCGLTTFIEAGAEESVNADLGDKQWEQKQIDGLDGEFPFTMWDDVNEKEDPIAEEQAGESPPDYSEYM
TGKKFPPEGIPGIDLSDPKQLAEFTSMRPKKPKGDFPRPIACSHKGCEKMFKDNSAMRKHLHIHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPYQCTFEGCGRRFSL
DFNLRTHVRIHTGDKPFVCPFDACNKKFAQSTNLKSHILTHVKNKNDQ*
15 >lcl|NP_001095079.1|Plus191101424..91101954 NT_039606 hypothetical protein LOC668814 Gm9376 __SEG__ Chr14 {Mus musculus} MKPETGEDPGKLCTHRRSDNGKLKEGTQVSSSLMMEEIDRMIVQMRLKDSKTVLISKTELTDVQFQKLRKHFETDCYPNEETLQAFAEELKLQKDVIRSWFITQRRRMMR
YRWFFTSYYRDWKTSCEYSTTRRFDRQKNSKECSQNDPGLPEELEALKRLKLSSGYQSRDGMSQDF*
16 >lcl|NP_001103445.1|Plus1complement(57761737..57763809) NT_039674 synaptopodin isoform B Synpo __SEG__ Chr18 {Mus musculus} MEGYSEEASLLRHLEKVASEEEEVPLVVYLKENAALLTANGLHLSQSRETQQSSPNPPDTEVPSPAADINQNPSSPNATLTTLASSSHHSQPTADINQNPPAAITPVPQN
SSQAQCSPNGTLDSKPGTLCADDGQSPVPAEEVRSSILLIDKVSAPPSAASTFSREATPLSSSGPPAADLMSSSLLIDMQPSTLVAPAEQEVPGHVAVTTPTKVYSEVHL
TLAKPASVVNRTARPFGIQSPGTSQIEQSPMMGRRQFGEKAWAPPASSMADRSPQPQRHIMSRSPMVERRLLGQRSPVLERRPLGNFTPPPTYAETLSTAPVASRVRSPP
SYSTLYPSSDPKPSHLKGQVAPANKTGILEESMARRGSRKSMFTFVEKPKVTPNPDLLDLVQTADEKRRQRDHGEVGMEEEPFALGAEASNFQQEPIARDRASPAAAEEA
VPEWASCLKSPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEKYVIESSGHAELARCPSPTMSLPSSWKYTTNAPGGFRVASLSPARTPPASLYHGYLPENGVLRPEP
TKQQPYQMRPSLYALSPVKEPAKASSRATSSRTPSRTVSPRAASPAKPSSLDLVPNLPRAGLPPSPALPRPSRSSPGLYTAPVQDSLQPTAVSPTYSSDISPVSPSRAWS
PRAKQAPRPSFSTRNAGIEAQVWKPSFCFK*
17 >lcl|NP_001128565.1|Plus1complement(154909..155886) NT_039341 Krueppel-like factor 14 Klf14 __SEG__ Chr6 {Mus musculus} MSAAVACLDYFAAECLVSMSTRAVLHRRATDPEGASAAAVSEVGAVSRESAGKGTGSRGVLWIPPVLQVPTPSPGEGDGAPHLLAASALADLSCGAREDFREDSEEAPCA
STSCFEPTWCSSPTGGSEPTQAFFEDELSDAESSCSDSAILDAPEASEEPDDSGEVPEGPPGARPAPSTGPTYRRRQITPASKRHQCSFHGCNKAYYKSSHLKSHQRTHT
GERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTYHPDMIEYRGRRRTPRPEPPPPAMVESSGSDSSSSSGQETSFTACL*
18 >lcl|NP_001135913.1|Plus123182618..23183136 NT_078575 predicted gene, ENSMUSG00000061104 Gm10094 __SEG__ Chr8 {Mus musculus} MLAAGVGGQGERLPGRRRKMAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAI
VFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPSSGRMRPY*
19 >lcl|NP_001136222.1|Plus17071044..7071739 NT_039713 TGFB-induced factor homeobox 2-like, X-linked 2 Tgif2lx2 __SEG__ ChrX {Mus musculus} MEEAEGSPEETQDFMKYYSSFGIRLERTCKMKFHDSRELPRGNMLPLKSVKILRDWLCEHQFNAYPTVADKRMLSKNTDLSYLQVSNWFVNIRKHLRWEIRYKPYSLSHE
GQAANAAQKQHSNPSEEVKTQFNENADMQDLPLPIRQDSEEKVPYLESSPNQKVIAEDNIEKEEKISITEPWSSPEVAWPEEKPDFSSFYMLVDVAVQKAKEMEEQKKQN
PNPQGPQQQFM*
20 >lcl|NP_001153701.1|Plus118182696..18183829 NT_039706 Zinc finger protein 275 isoform 2 Zfp275 __SEG__ ChrX {Mus musculus} MGEEAQLQEMASTSSPRANDPSAEVKQNGDSGGRGGSPQNLPIEHHFACKECGDTFRLKVLLVQHQRVHSEEKGWECGDCRKVFRGVSEFNEHRNSHAAVAAQPRPGPSR
ALEDALEKREQMEREAKPFECEECGKRFKKNAGLSQHLRVHSREKPFDCEECGQSFKANTHLFRHQKLHTSEKPFACKACSRDFLDRQELLKHQRMHTGHLPFDCDDCGK
SFRGVNGLAEHQRIHSGAKPYGCPHCGKLFRRSSELTKHRRIHTGEKPYECNQCGKAFRQSSSLLEHTRIHSGERPYACGDCGKAFRGPSDLIKHRRIHSGLKPYECDKC
GKAFRRSSGLSRHRRIHSGVKRCECSECGRVFKRRSALQKHQPSHRE*
21 >lcl|NP_001155327.1|Plus1complement(57880926..57882062) NT_039500 RIKEN cDNA 4933416C03 4933416C03Rik __SEG__ Chr10 {Mus musculus} MSKSRDEPPHELENQFILRLPPEQASAVRKIIRSGNAAMREKLKIDLSPDSRRAVVQVDGVSLSAKLVDLPCVIGSLKTHDGKTFYKTADVSQMLLCSADDGDPHTSPEE
PATSAGATVVGNKKEAEGKYIWKHGITPPLKNVRKKRFRKPTKKPADMKQGEESCRAYIDSKDVEKEVKRLLRSDAEAISSRWEVVVDDETKAVPSQTCTSHVPLPPEAG
DHTSSACAMPQSTFSDSSSGKDDPENKDEEEEEEKEEKEEEDEDEEDEEEEEEEEEDDSEEDLERELQAKFIEFSLCEANESSSSVILGIQKLIHSKERKLQEIQAKAQR
QKDLLRKLENLTLKSHFQSVLDQLKLQEKQKYEQILFLQEQLKCFLKK*
22 >lcl|NP_001157086.1|Plus127722623..27723057 NT_039500 achaete-scute complex homolog 4 Ascl4 __SEG__ Chr10 {Mus musculus} MEKRRSAGLLALPSALRTAPLGALPGREPCRVSVRQDAADCARRRPYSSLPLGGVAEPAFLRQRNERERQRVRCVNEGYARLRQHLPRELAGQRLSKVETLRAAISYIKQ
LQELLERHRPDCNSDGESKASSGASPCSESEERS*
23 >lcl|NP_001157305.1|Plus148538445..48539560 NT_039492 male-specific lethal 3-like 2 Msl3l2 __SEG__ Chr10 {Mus musculus} MATLGCAPKDDGEGKDEGGSDRGDGDSKPKGKKEVEPHTRREADERAMRIPIPEVLQQRLADDCYYINRRRRLVRLPCQTNVGAILECYVRHFSASVLALGDRRPQPQRA
APERSVGLCREMADGLRITFDHALPLVLLYPQEQAQYEMVTSSTFFFPTEERASDAGRSQEAPWPGPSPPQPSESQAVAGPAAPKRRRAEAEATRAPRRSTRHSTHCHWQ
AEDRASPQAKRSVPKLFPHLQKTPVHSAAPSPIALTPGKEGSAMFAGFEGTTEEINEILSWKLVPDNYPPGHQPPPPSYIYGAQHLLRLFVKLPEILGKMSFSEKNLKAL
LKHLDLFLRFLAEYQADFFLESAYVSACEAHYSSKNPRTLC*
24 >lcl|NP_001160053.1|Plus128418754..28423523 NT_109320 cDNA sequence BC005561 BC005561 __SEG__ Chr5 {Mus musculus} MAMTSTTVVVPAEWIKTWEKSGRGEFLRLCRILSESKSRDTFAWRDFQQALYELSYHVIKGTLKPEQASNVLNDISEFREDIPFILADIFCILDIETNCLEEKSKRDHFT
QLILACLYLVSDTVLKERLDPETLGSLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIVELGQDLSGNITSDLILEILKSLIGCFNLDPNRVLDIILEVF
ECRPEHHDFFISLLEAYMSMCEPHTLCHILGFKFKFYQEPNGETPSSLYRAAAVLLQFNLIDLDDLYVHLLPADSCIVSEYKREIVEAKQIVKKLTMVVLPSEKSDEREK
EKKKDDKVEKAPDNQKLGLLEALLIIGDWKHAQSIMDHMPPYYATSHKVIALAICNLIHITIEPIYRRVGVPKGAKGSPVNALQNKKAPKQAESFEDLRRDVFSMFYYLG
PHLSHDPILFAKVVRIGKSFMKEFQSDGKQENKEKMEAILSCLLSVTDQVLLPSLSLMDCNACMSEELWGMFKTFPYQHRYRLYGQWKNETYNSHPLLVKVKAYTIDRAK
YIMKRLTKENVKPSGRQIGKLSHSNPTILFDYILSQIQKYDNLITPVVDSLKYLTALNYDVLAYCIIEALANPEKERMKHDDTTISNWLQSLASFCGAVFRKYPIDLAGL
LQYVANQLKAGKSFDLLILKEVVQKMAGIEVTEEMTMEQLEAMTGGEQLKAEGGYFGQIRNTKKSSQRLKDALLDHDLALPLCLLMAQQRNGVIFQEGGEKHLKLVGKLY
DQCHDTLVQFGGFLASNLSTDDYIKRVPSIDVLCNEFHTPHDAAFFLSRPMYAHHISSKYDELKKSEKGSKQQHKVHKYIMSCEMVMAPVHEAVVSLHISKVWDDISPQF
YTTFWSLTMYDLAVPHTSYEREVNKLKIQMKAVDDSQEMPLNKKKKEKERCTALQDKLLEEEKKQTEHVQRVLHRLKLEKDNWLLAKSTKNETITKFLQLCIFPRCIFSA
IDSVYCAHFVELVHQQKTPNFSTLLCYDRVFSDIIYMVASFTENEASRYGRFLCCMLETVTRWHSDRSTYEKECGNYPGFLTILRATGFDGGNKADQLDYENFRHVVHKW
HYKLTKASVHCLETGEYTHIRNILIVLTKILPWYPKVLNLGQALERRVHKICQEEKEKKPDLYALAMVYSGQLKSRKSYMIPENEFHHKDPPPRNTATNLQPSGPCSGLP
SSIGSMCKLDESSAEEADKSRERAQCAVKAANKASSVTPKGNLSNGNSGSNSKAVKENDKEKGKEKEKEKKEKTPAVTPEARVLGKDSKEKPKEEQPNKDEKIREAKERM
PKSDKDKEKLKKEEKAKDEKFRIIVANVESKSTQEREKEKEPSKERDLAKEMKSKENVKGGEKAPVSGSLKSPISRTDITEPEREKRRKVDSHPSPSHSSTIKDSLVKLK
ESSAKLYINHIPPLLCKSKEREADKKDLDKSRERSREREKKEEKDRKERKRDYSNNDREAPLDLIKRRKDENGILGVSKHKSESPCESLYPNEKDKEKMKSKSSGKEKGD
SFKPEKIDKISSGKKESGHDKEKIEKKEKWDGSGDKEEKKHHKTSDKHR*
25 >lcl|NP_001171041.1|Plus139401287..39404250 NT_096135 zinc finger protein 616 Zfp616 __SEG__ Chr11 {Mus musculus} MVCTQNYFQKEITQVFGLNGLLDLYRKKFWEYRSGGEEHEICDYENYLLAKHICFNSEKNKGVLAIPERTQAESLPFLQLETTLAEFLQILKCNNVLHRNTKTLKSDIWV
NKPTSLKHLSSSMGFNSTSILYEQRRYWRREKITEYHQCERYFSKNSLQLPQQLNLLCDKFYHVGQHKKMSMYAVKLGTYHVEGSCGNSNRVNDSNMGYIKNPFLKYCQN
NQHGEILYQGDVILYDSHHETILSKNEISKCISENHYNHDSRQAMSNHCSQSSLQQQDHTTWSLYKNDWQDDILNDSLILQVYNRMWTKGDFNKYTCDTYRNALIESLYL
EKDNMKHIKRQLSQAPGYNKVLNFNSNVIQHDSNHNGKGIQKVKVHLYGIFNIQNLLRHSNLSVEEKPSKYKTPEKCSNKSSGLMVFQARGKPWKCVQCGKSFAQYSALQ
NPHRICTVKKLYSCKECLKSFTWFSKLQAHHRIHTTQELYKSNKCGESFTQSSNLQVYQRIHHTGDKPYKCNECGKYFTHSSSLKDHQRIHARHKPYKCNNCGKSFIKSS
DLKGHYRIHTGDKPYKCNNCRKSFTQSSGLKRHYRIHTGDKPYKCNECGKYFTQSSNLQVHQRIHTKDKPYKCNECGKYFAHSSSLKVHHRIHTRNKTYKCNNCGKSFIR
SSDLKRHYRIHTGNKPYKCNDCGKYFTHSSSLKGHHRIHTRDKPYKCNNCGKSFRQSSSLKRHYRIHTGDKPYKCNECGKYFACSSSLKRHHRIHTGDKPYKCNECGKYF
AQSSNLQVHQRIHTKDKPYKCNECGKYFARSSSLKNHHRIHTGDKPYKCNECGKYFAQSSNLQVHQRIHTKDKPYKCNECGKYFAQYSNLQVHQRIHTKDKPYKCNECGK
YFARSSSLKDHHRIHTGDKPYKCNECGKYFAQSSNLQVHQRIHTKDKPYKCNECGKYFAQYSNLQVHQRIHTGDKPYKCNECGKYFASSSNLKVHHRIHTGYKPLQM*
26 >lcl|NP_031526.1|Plus116992279..16993334 NT_039353 protein atonal homolog 1 Atoh1 __SEG__ Chr6 {Mus musculus} MSRLLHAEEWAEVKELGDHHRHPQPHHVPPLTPQPPATLQARDLPVYPAELSLLDSTDPRAWLTPTLQGLCTARAAQYLLHSPELGASEAAAPRDEADSQGELVRRSGCG
GLSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPNVGEQ
PPPPTASCKNDHHHLRTASSYEGGAGASAVAGAQPAPGGGPRPTPPGPCRTRFSGPASSGGYSVQLDALHFPAFEDRALTAMMAQKDLSPSLPGGILQPVQEDNSKTSPR
SHRSDGEFSPHSHYSDSDEAS*
27 >lcl|NP_031527.1|Plus1complement(72038854..72039846) NT_039500 neurogenic differentiation factor 4 Neurod4 __SEG__ Chr10 {Mus musculus} MAKMYMKSKDMVELVNTQSWMDKGLSSQNEMKEQERRPGSYGMLGTLTEEHDSIEEDEEEEEDGDKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNL
RRVMPCYSKTQKLSKIETLRLARNYIWALSEVLETGQTLEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQSTLLEKHEEKSSICDSTISVHSFNYQSPGLPSPPYGHMETH
SLHLKPQPFKSLGDSFGSHPPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYNFMPHYTSASLSSGHVHSTPFQTGTPRYDVPVDLSYDSYSHHSIGTQLNTIFSD
*
28 >lcl|NP_031704.2|Plus132904438..32905517 NT_039413 CCAAT/enhancer-binding protein alpha Cebpa __SEG__ Chr7 {Mus musculus} MESADFYEVEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAP
AGPGGAVMSAGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGH
PTPPPTPVPSPHAAPALGAAGLPGPGSALKGLAGAHPDLRTGGGGGGSGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVE
QLSRELDTLRGIFRQLPESSLVKAMGNCA*
29 >lcl|NP_031881.1|Plus16354526..6355008 NT_078297 twist-related protein 2 Twist2 __SEG__ Chr1 {Mus musculus} MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLA
ARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH*
30 >lcl|NP_032048.1|Plus1complement(18085885..18087219) NT_039687 forkhead box protein D4 Foxd4 __SEG__ Chr19 {Mus musculus} MNSARAGHLRSTPPPSPLSSDQDEVEIDVLAEEEDGDQTEEEDDEEESHKCLERSLQRPGARTLAGRSAGDCGDLSNSSGFLRKFRAPRTPATTTADGPQPAKPPYSYIA
LITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLRRRKRFKRHHPPSGGHPHCPFPPPAVP
ATLHVSQPSLLLRYSAPPQPNLAAHPAAPPRSHPCAPLHPHPMRYLLLAAPAYGDNPRKAEGADPATPLAIPALQPVLGSQPWERDQSSGTRSGRGCASFTIESIMQGVT
GGGTGSAQSPSFAPWSYCHLLQHPPCLLHPQAASPLFHMSAGSRTILPQQPQPPLPLQQEQHHCAISCAPGKGVRLGQHLSAVAALLRQQPAADDGRLTTLAALSGREGT
LPEF*
31 >lcl|NP_032049.1|Plus1complement(10058739..10060025) NT_039687 forkhead box protein B2 Foxb2 __SEG__ Chr19 {Mus musculus} MPRPGKSSYSDQKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPDCGDMFENGSFLRRRKRFK
VLRADHAHLHSGSSKGAPGTGPGGHLHPHHPHHAHHHHHHHHHAAHHHHHHHPPQPPPPPPPHMVPYFHQQPAPAPQPPHLPSQPAQQPQPQSQPPQTSHPGKMQEAAAV
AAAAAAAAAAAVGSVGRLSQFPPYGLGSAAAAAAAAAASTTGFKHPFAIENIIGRDYKGVLQAGGLPLASVMHHLGYPVPGQLSNVVGSVWPHVGVMDSVAAAAAAAAAA
GVPVGPEYGAFGVPVKALCHSANQSLPAVPVPIKPTPALPPVTTLPPALSVPTASQQLPAPSTVCAAAASPTAPLLEPTAAGRADSKGSSLHSVLVHS*
32 >lcl|NP_032050.2|Plus148485216..48486226 NT_078575 forkhead box protein L1 Foxl1 __SEG__ Chr8 {Mus musculus} MSHLFSPPLAALAASPLLYVYSPERPGLPLAFAPAAALAGPGRVEPPQKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNECFVKV
PREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPAAGSPEAKRTRVEPPESEVGCDVGSPDLATALPTRAPDRSQSPAVGTARPALLPWPGPEPRDPDADLTVQGAG
AVASGQLQRPAHHLGSPLCPAPSGSPKGSKSKSFSIDSILAVRPTPASGAEAPGIPKPVPGALGSSLLAASSGLAPPFNASLVFDAHVQGGFSQLGIPFLSYFPLQVPEA
TVLRFH*
33 >lcl|NP_032258.2|Plus1complement(15687765..15688616) NT_039578 hepatoma derived growth factor-like 1 Hdgfl1 __SEG__ Chr13 {Mus musculus} MSCFSRSKYKTGDLVFAKLKGYAHWPARIEHVAEANRYQVFFFGTHETALLGPRHLFPYEESKEKFGKPNKRRGFSEGLWEIEHDPMVEASSSLCSEEDQSYTEDPGLAE
EPELGQELVQELEPEFMPELEAEPEMPETECEQEPEPQPAYDLLDAVEEPGLTKAEPGDQQAEHVQEKHPEVEAEAEAEAEAEAEAEAEAKAEVEEPGSLKRSAEDEEPH
CPLKRPREAAPGALEMEPAEEREAEACPFVEEPDQAQEQLPPLEEEATEKAVQGLIVGEIEGL*
34 >lcl|NP_032265.3|Plus120477445..20478647 NT_039578 forkhead box protein Q1 Foxq1 __SEG__ Chr13 {Mus musculus} MKLEVFVPRAAHGDKMGSDLEGAGSSDVPSPLSAAGDDSLGSDGDCAANSPAAGSGAGDLEGGGGERNSSGGPSAQDGPEATDDSRTQASAAGPCAGGVGGGEGARSKPY
TRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRTTVSA
SGLRPEEAPPGPAGTPQPAPAARSSPIARSPARQEERSSPASKFSSSFAIDSILSKPFRSRRDGDSALGVQLPWGAAPCPPLRAYPALLPAAPGGALLPLCAYGASEPTL
LASRGTEVQPAAPLLLAPLSTAAPAKPFRGPETAGAAHLYCPLRLPTALQAAAACGPGPHLSYPVETLLA*
35 >lcl|NP_032267.1|Plus17810687..7812132 NT_039551 forkhead box protein G1 Foxg1 __SEG__ Chr12 {Mus musculus} MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHHHHHHHHPPPPAPQPPPPPPQQQQQQPPPAPQPPQARGAPAADDDKGPQPLLLPPSTALDG
AKADALGAKGEPGGGPAELAPVGPDEKEKGAGAGGEEKKGAGEGGKDGEGGKEGDKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNS
IRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHP
MPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTSYFFPHVPHPSMTSQTSTSMSARAASSSTSPQAP
STLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNPLIH*
36 >lcl|NP_032268.2|Plus16333224..6334594 NT_039590 forkhead box protein D1 Foxd1 __SEG__ Chr13 {Mus musculus} MTLSTEMSDASGLAEETDIDVVGEGEDDEEEEDDDDEGGGGRGGGGSRLPSSAQRRRRSYAGEDDLEDLEEEDDDDLLLASRPAASPAPPGPAPAPGTGSGGCSGAGAGG
GAGGGTGAGTGGGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISSRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFL
RRRKRFKRQPLLAPHAAAEALLLRGAGPAAGAGDPGAALFPPPPPPPACGYGAYGCAYGLQLPPCAPPSALFAAAAAAAAAAFHPHSPPPPPPPPPPPPGAAAELARTAF
GYRSHALAAALPGPLQAAAVKAGGPGAAALARSPFSIESLIGRTRGPAAAGAHVSSGAASGTAPGPGGGGCAVQAAAGPAVALTRSLVVAAAAAASSVSSSAALGTLHQG
TALSSVENFTARISNC*
37 >lcl|NP_032438.2|Plus1complement(41757625..41759031) NT_039240 involucrin Ivl __SEG__ Chr3 {Mus musculus} MSHQHTLPVTVPAVVQGPLKTVCSPDHIQQEQAKQPTPHPTQCQVFTEIQEKGFPKHEEKRPNPVKDLPDQKCEHQQQPGPQKQQLQVKKSQQELQEQELHLEKQQLPQE
PQGLLCLEQQQQQEPQMQEQHLRQQQQQQQQQQQQQQQQQQQETQEQGLCLGQQKQQQQQQDMLVPQELHLRQHQEKLQDPELHLGQQQKTPEEQKLIPGEKQQELHLGQ
RHQEPQEQELHLGQKQKQKLHEPELQLGKQQHQKPSEPELPLGKQQQESPEPELPLGKQQQQESPEPELQLGKQQQSHEPDMAGDQKEKQKLHKPELYLRKQQYQESPDP
ELSLGKQQHQECQEPELQLEEKQHQKPPEPELHLGKQQESHEPDMAEDLEEKQKLGEPELHLGKQQQQQIEREGYQGPKSLGQSLKQEKASRKQQLDYSHLEQEKELSDQ
PLDQALVKKGKQLERKKHELENRTQQEK*
38 >lcl|NP_032442.1|Plus1complement(12334648..12335682) NT_078575 transcription factor jun-B Junb __SEG__ Chr8 {Mus musculus} MCTKMEQPFYHDDSYAAAGYGRSPGSLSLHDYKLLKPTLALNLADPYRGLKGPGARGPGPEGSGAGSYFSGQGSDTGASLKLASTELERLIVPNSNGVITTTPTPPGQYF
YPRGGGSGGGTGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGASGGPQAGPGGVYAGPEPPPVYTNLSSYSPASAPSGGSGTAVGTGSSYPTATISYLPHAPPFA
GGHPAQLGLSRGASAFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSAAGLLREQVAQLKQKVMTHVS
NGCQLLLGVKGHAF*
39 >lcl|NP_032534.2|Plus1complement(41266792..41268252) NT_039240 loricrin Lor __SEG__ Chr3 {Mus musculus} MSHQKKQPTPCPPVGCGKTSGGGGGGGGGGGGGYYSGGGSGCGGGSSGGGSSCGGGGGGSYGGGSSCGGGGGSGGGVKYSGGGGGSSCGGGYSGGGGGSSCGGGYSGGGG
GSSCGGGYSGGGGGSSCGGGSYSGGGSSCGGGGGSGGGVKYSGGGGGGGSSCGGGSSGGGGGGSSCGGGSGGGGSYCGGSSGGGSSGGCGGGSGGGKYSGGGGGSSCGGG
YSGGGGSSGGSSCGGGYSGGGGSSCGGGGGYSGGGGSSCGGGSSGGGGGGSSQQYQCQSYGGGSSGGSSCGGRYSGGGGSSCGGGYSGGGGSSCGGGSSGGGSSCGGSGG
GGYSGGGGGSCGGGSSGGGGGYYSSQQTSQTSCAPQQSYGGGSSGGGGSCGGGSSGGGGGGGCYSSGGGGSSGGCGGGYSGGGGGCGGGSSGGSGGGCGGGSSGGSGGGC
GGGYSGGGGGGSSCGGGSSGGGSGGGKGVPVCHQTQQKQAPTWPCK*
40 >lcl|NP_032579.2|Plus1complement(29286525..29287220) NT_039500 achaete-scute homolog 1 Ascl1 __SEG__ Chr10 {Mus musculus} MESSGKMESGAGQQPQPPQPFLPPAACFFATAAAAAAAAAAAAQSAQQQQPQAPPQQAPQLSPVADSQPSGGGHKSAAKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQ
QPAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPE
EQELLDFTNWF*
41 >lcl|NP_032618.2|Plus120725736..20727397 NT_039578 forkhead box protein C1 Foxc1 __SEG__ Chr13 {Mus musculus} MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGSMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMD
RFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKGRLHLQEPPPPQAGRQPAPAPPEQAEGSAPGPQP
PPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAATVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDAAEPAPPPQPAPPPHHSQGFSVDNIMTSLRGSPQGSAAELGS
GLLASAAASSRAGIAPPLALGAYSPGQSSLYSSPCSQSSSAGSSGGGGGGGGGGGGSSSAAGTGGAATYHCNLQAMSLYAAGERGGHLQGPAGGAGSAAVDDPLPDYSLP
PATSSSSSSLSHGGGGQEASHHPASHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPASQSLYRTSGAFVYDC
SKF*
42 >lcl|NP_032619.1|Plus1complement(15031147..15032625) NT_039264 forkhead box protein D2 Foxd2 __SEG__ Chr4 {Mus musculus} MTLGSCCCEIMSSESSPAALSEPDADIDVVGGGSGGGELTARSGPRAPRDVLPHGHEPPPEEAEADVAEDEEESGGCSDCEPRALAPRGAAAAAGSPGPGVQAARGATGP
GPGPGPPSGGAATRSPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLR
RRKRFKRQPLPPPHPHPHPHPELLLRGGAAAAGDPGAFLSSFAAYGAYGYGYGLALPAYGAPPPGPAPHPHPHPHAFAFAATAPCQLSVPPGRAAAPPPGPPTASVFASA
ASAPAPAPAPGSGPSPAGLPAFLGAELGCAKAFYPASLSPPAAGTAASLSTALLRQGLKTDAGGGAGGGGAGTGQRPSFSIDHIMGHGGGGAAPPGSGDGSPGSPFAAAA
GPGGQAQVLAMLTAPALTPVAGHIRLSHPGDSLLSSGPSFASKVAGLSGCHF*
43 >lcl|NP_032642.2|Plus170134283..70134888 NT_039353 zinc finger protein 239 Zfp239 __SEG__ Chr6 {Mus musculus} MAEKPYKCDKCGKGFTRSSSLLVHHSVHTGEKPFKCDRCGKGFSQSSKLHIHKRVHTGEKPYACEECGMSFSQRSNLHIHQRVHTGERPYKCGECGKGFSQSSNLHIHRC
THTGEKPYQCYECGKGFSQSSDLRIHLRVHTGEKPYHCGKCGQGFSQSSKLLIHQRVHTGEKPYECSKCGKGFSQSSNLHIHQRVHRKELH*
44 >lcl|NP_032925.1|Plus1complement(19413941..19415278) NT_039258 POU domain, class 3, transcription factor 2 Pou3f2 __SEG__ Chr4 {Mus musculus} MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSHGGGGGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQ
QGGRGDELHGPGALQQQHQQQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPSMGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDA
HDEPHHADHHPHPHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLL
NKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGV
QTPVQ*
45 >lcl|NP_032926.2|Plus120280642..20282135 NT_039170 POU domain, class 3, transcription factor 3 Pou3f3 __SEG__ Chr1 {Mus musculus} MATAASNPYLPGNSLLTAGSIVHSDAAGAGGGGGGGGGGGGGAGGGGGGMQPGSAAVTSGAYRGDPSSVKMVQSDFMQGAMAASNGGHMLSHAHQWVTALPHAAAAAAAA
AAAAVEASSPWSGSAVGMAGSPQQPPQPPPPPPQGPDVKGGAGREDLHAGTALHHRGPPHLGPPPPPPHQGHPGGWGAAAAAAAAAAAAAAAAHLPSMAGGQQPPPQSLL
YSQPGGFTVNGMLSAPPGPGGGGGGAGGGAQSLVHPGLVRGDTPELAEHHHHHHHHAHPHPPHPHHAQGPPHHGGGGAGPGLNSHDPHSDEDTPTSDDLEQFAKQFKQRR
IKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSL
QLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTSVQ*
46 >lcl|NP_032927.1|Plus155593911..55594996 NT_039706 POU domain, class 3, transcription factor 4 Pou3f4 __SEG__ ChrX {Mus musculus} MATAASNPYSILSSSSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNH
PNAWGASPAPNSSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASTQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALG
TLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRR
QKEKRMTPPGDQQPHEVYSHTVKTDASCHDL*
47 >lcl|NP_033015.1|Plus133446816..33447781 NT_039674 transcriptional activator protein Pur-alpha Pura __SEG__ Chr18 {Mus musculus} MADRDSGSEQGGAALGSGGSLGHPGSGSGSGGGGGGGGGGGGSGGGGGAPGGLQHETQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFR
DYLGDFIEHYAQLGPSQPPDLAQAQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEG
TSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEMKKIQEKQREKRAACEQLHQQQQQQQEETTAATLLLQGEEEGEED*
48 >lcl|NP_033259.2|Plus19396361..9397536 NT_039455 transcription factor SOX-1 Sox1 __SEG__ Chr8 {Mus musculus} MYSMMMETDLHSPGGAQAPTNLSGPAGAGGGGGGGGGGGGGGGTKANQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKVMSEAEKRPFIDEAKRLRAL
HMKEHPDYKYRPRRKTKTLLKKDKYSLAGGLLAAGAGGGGAAVAMGVGVGVGAAAVGQRLESPGGAAGGGYAHVNGWANGAYPGSVAAAAAAAAMMQEAQLAYGQHPGAG
GAHPHAHPAHPHPHHPHAHPHNPQPMHRYDMGALQYSPISNSQGYMSASPSGYGGIPYGAAAAAAAAAGGAHQNSAVAAAAAAAAASSGALGALGSLVKSEPSGSPPAPA
HSRAPCPGDLREMISMYLPAGEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTHI*
49 >lcl|NP_033260.4|Plus1complement(25026086..25027273) NT_039548 transcription factor SOX-11 Sox11 __SEG__ Chr12 {Mus musculus} MVQQAESSEAESNLPRDALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHM
ADYPDYKYRPRKKPKTDPAAKPSAGQSPDKSAAGAKAAKGPGKKCAKLKAPAGKAGAGKAAQPGDCAAGKAAKCVFLDDDDEDDDEDDELQLRPKPDADDDDDEPAHSHL
LPPPTQQQPPQLLRRYSVAKVPASPTLSSAAESPEGASLYDEVRAGGRLYYSFKNITKQQPPPAPPALSPASSRCVSTSSSSGSSSGSGAEDADDLMFDLSLNFSQGAHS
ACEQPLGAGAAGNLSLSLVDKDLDSFSEGSLGSHFEFPDYCTPELSEMIAGDWLEANFSDLVFTY*
50 >lcl|NP_033263.2|Plus1complement(5729360..5730712) NT_039706 transcription factor SOX-3 Sox3 __SEG__ ChrX {Mus musculus} MRPARENASGERSPRVPADFARSPSASLPFPPELPARRPLSTTPTESPGLFTVAAPAPGAPSPPATLAHLLPAPAMYSLLETELKNPVGPPTPAAGTGVPAAPGAAGKSG
ANPAGGANAGNGGSGGANGGGGGGGGGGSDQDRVKRPMNAFMVWSRGQRRKMALENPKMHNSEISKRLGADWKLLTDAEKRPFIDEAKRLRAVHMKEYPDYKYRPRRKTK
TLLKKDKYSLPGGLLPPGAAAAAAAAAAAAAASSPVGVGQRLDTYTHVNGWANGAYSLVQEQLGYAQPPSMSSPPPPPALPQMHRYDMAGLQYSPMMPPGAQSYMNAAAA
AAAASGYGGMAPSAAAAAAAAYGQQPATAAAAAAAAAAMSLGPMGSVVKSEPSSPPPAIASHSQRACLGDLRDMISMYLPPGGDAADAASPLPGGRLHGVHQHYQGAGTA
VNGTVPLTHI*
51 >lcl|NP_033264.2|Plus1complement(17870227..17871549) NT_039578 transcription factor SOX-4 Sox4 __SEG__ Chr13 {Mus musculus} MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIQ
EAERLRLKHMADYPDYKYRPRKKVKSGNAGAGSAATAKPGEKGDKVAGSSGHAGSSHAGGGAGGSSKPAPKKSCGPKVAGSSVGKPHAKLVPAGGSKAAASFSPEQAALL
PLGEPTAVYKVRTPSAATPAASSSPSSALATPAKHPADKKVKRVYLFGSLGASASPVGGLGASADPSDPLGLYEDGGPGCSPDGRSLSGRSSAASSPAASRSPADHRGYA
SLRAASPAPSSAPSHASSSLSSSSSSSSGSSSSDDEFEDDLLDLNPSSNFESMSLGSFSSSSALDRDLDFNFEPGSGSHFEFPDYCTPEVSEMISGDWLESSISNLVFTY
*
52 >lcl|NP_033343.1|Plus111637768..11638094 NT_109315 T-cell acute lymphocytic leukemia protein 2 homolog Tal2 __SEG__ Chr4 {Mus musculus} MTRKIFTNTRERWRQQSVNNAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLHQTGVAAQGNILGLFPPKTRLPDEDDRTLLNDYRVPSPGPSHGAP*
53 >lcl|NP_033566.3|Plus1complement(44966270..44968498) NT_039492 zinc finger autosomal protein Zfa __SEG__ Chr10 {Mus musculus} MKMDLNYNNKHQTHFLMQQELVAPHMDGSQIVVEVQETVYVSDVVDSDIIVHNYVPDDPDSVVIQDVIEDVVIEDVQCTDIMDEADVSETVIIPEQVLNSDVTEEVSLTH
CTVPDDVLASDITSASISMPKRVLTSESIHVSDIGHVEHVVHDSVVEAEIITDPLATDVVSEEVLVADCASEAVIDANRIPVNQQDEEKNNCEDYLMISCGTVDIVESEP
ENELGVELLDPNNSICVPREKMVYMAVNNSQQEEELNVTEIADEIYMEVIVGEEDATASEHEQQVEDNKMKTFMPIAWEAAYGNNSDGIENRNGTASALLHIDESAGLGR
LAKQKPKKRRPDSRQYQTAIIIGPDGHPLTVYPCMICGKKFKSRGFLKRHMKNHPEHLAKKKYRCTDCDYTTNKKISLHNHLESHKLTSKAEKAIECDEYGKHFSHAGAL
FTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHLLAVHSKNFPHICVECGKGFCHPSELKKHMRIHTGEKPYECQYCEYRSTDSSNLKTHVKTKHSKEMPFKCDICLLT
FSDTKEVQQHALVHQESKTHQCLHCDHKSSNSSDLKRHIISVHTKDYPHKCDMCDKGFHRPSELKKHVAAHKGKKTHQCRHCDFKIADPFVLSRHILSVHTKDLPFRCKR
CRTRFRQQSELKKHMKTHSGQKVYQCEYCDYSTTDASGFKRHVISIHTKDYPHCCEHCKKGFRRPSEKNQHIMRHHKEVGLP*
54 >lcl|NP_033582.2|Plus1complement(4142806..4143672) NT_039460 zinc finger protein 42 Zfp42 __SEG__ Chr8 {Mus musculus} MNEQKMNEQMKKTAKTSGQKGPGGRALDRLTLKQDEARPVQNTRVEAPRVTYTIRDESEISPETEEDGFPDGYLECIIRGEFSEPILEEDFLFKSFESLEEVEQNLSRQV
LEASSLLESSLEYMTKGTKQEKREVTQETPPLRVGASSLLAGGPAEKPEGGVYCGVLSMLECPQAGCKKKLRDKTALRKHMLVHGPRRHVCAECGKAFTESSKLKRHFLV
HTGEKPYQCTFEGCGKRFSLDFNLRTHIRIHTGERRFVCPFDGCEKSFIQSNNQKIHILTHAKAGKKC*
55 >lcl|NP_033847.1|Plus1complement(7941593..7942606) NT_039353 neurogenic differentiation factor 6 Neurod6 __SEG__ Chr6 {Mus musculus} MLTLPFDESVVMPESQMCRKFARQCEDQKQIKKPESFPKQVVLRGKSIKRAPGEETEKEEEEEDREEEDENGLSRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGL
NDALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGCLQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELATPP
GHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFPYDLHLRSQSLTMQDE
LNAVFHN*
56 >lcl|NP_033848.1|Plus176719000..76719791 NT_039240 neurogenin-2 Neurog2 __SEG__ Chr3 {Mus musculus} MFVKSETLELKEEEEVLMLLGSASPASATLTPMSSSADEEEDEELRRPGSARGQRGAEAGQGVQGSPASGAGGCRPGRLLGLMHECKRRPSRSRAVSRGAKTAETVQRIK
KTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCAGAGGLQGALFTEAVLLSPGAALGASGDSPSPPSSWSCTNSPASSS
NSTSPYSCTLSPASPGSDVDYWQPPPPEKHRYAPHLPLARDCI*
57 >lcl|NP_033849.3|Plus13927598..3928242 NT_039500 neurogenin-3 Neurog3 __SEG__ Chr10 {Mus musculus} MAPHPLDALTIQVSPETQQPFPGASDHEVLSSNSTPPSPTLIPRDCSEAEVGDCRGTSRKLRARRGGRNRPKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVL
PTFPDDAKLTKIETLRFAHNYIWALTQTLRIADHSFYGPEPPVPCGELGSPGGGSNGDWGSIYSPVSQAGNLSPTASLEEFPGLQVPSSPSYLLPGALVFSDFL*
58 >lcl|NP_034013.1|Plus1108555824..108556714 NT_039207 CCAAT/enhancer-binding protein beta Cebpb __SEG__ Chr2 {Mus musculus} MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERAIDFSPYLEPLAPAADFAAPAPAHHDFLSDLFADDYGAKPSKKPADYGYVS
LGRAGAKAAPPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLSTSSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKTVDK
LSDEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC*
59 >lcl|NP_034014.1|Plus1complement(32835403..32835855) NT_039413 CCAAT/enhancer-binding protein gamma Cebpg __SEG__ Chr7 {Mus musculus} MSKLSQPATTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVPPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKL
LTKELSVLKDLFLEHAHSLADNVQPISTETTATNSDNPGQ*
60 >lcl|NP_034356.1|Plus1complement(93799180..93800169) NT_039207 forkhead box protein S1 Foxs1 __SEG__ Chr2 {Mus musculus} MQKQPSPESLAPSAEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFQHGSFLRR
RRRFTKRTGAQGTKGPVKIDHRPHRATSPDPGAPKTTTGRLCPFPQEVPNPKGLSFEGLMGSLPANMSSTTSDVRPQLPTGPKEMCSAKSGGPRELSEATSPSPCPAFGF
SSAFSDAESLGKAPTPGVAPESVGSSYQCRMQTLNFCMGTDPGLEHLLVSSVPTPGSSTPSASHRAPLPLPADSKEPWVAGSFPVQGGSGYPLGLPPCLYRTPGMFFFE*
61 >lcl|NP_034555.3|Plus110310608..10312017 NT_039280 forkhead box protein D3 Foxd3 __SEG__ Chr4 {Mus musculus} MTLSGSGSASDMSGQTVLTAEDVDIDVVGEGDDGLEEKDSDAGCDSPAGPPDLRLDEADEGPPVSAHHGQSQPQALALPTEATGPGNDTGAPEADGCKGGEDAVTGGGGP
GAGSGATGGLTPNKPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSF
LRRRKRFKRHQQEHLREQTALMMQSFGAYSLAAAAGAGPYGRPYGLHPAAAAGAYSHPAAAAAAAAAAALQYPYALPPVAPVLPPAVPLLPSGELGRKAAAFGSQLGPSL
QLQLNTLGAAAAAAGTAGAAGTTSLIKSEPSARPSFSIENIIGAGSAAPGGSAGGGGSGGGAGGGGGSGGGGGAQSFLRPPGTVQSAALMATHQPLSLSRTTATIAPILS
VPLSGQFLQPAASAAAAAAAAVQAKWPAQ*
62 >lcl|NP_034702.2|Plus1complement(572020..575670) NT_039718 insulin receptor substrate 4 Irs4 __SEG__ ChrX {Mus musculus} MASCSFSGHQALRRLRASAAAAASAALAAVATTPLLSSGTRTALIGTGSSCPGAMWLSTATGSRSDSESEEEDLPVGDEVCKRGYLRKQKHGHRRYFVLKLETADAPARL
EYYRNARKFRHSVRAAAAAAEAAASGAAVPALIPPRRVIILYQCFSVSQRADARYRHLIALFTQDEYFAMVAENESEQESWYLLLSRLILESKRRRCGTLGALPDGEPAA
LAAAAAAEPPFYKDVWQVVVKPRGLGHRKELSGVFRLCLTDEEVVFVRLNTEVASVVVQLLSIRRCGHSEQYFFLEVGRSTVIGPGELWMQVDDSVVAQNMHELFLEKMR
ALCADEYRARCRSYSISIGAHLLTLLSTRRHLGLLPLEPGGWLRRYGLEQFCRLRAIREREEMLFTRRFISPREPPPPFRRGRGHLPRARRSRRAASVPPSLFRRSAPSP
GRIPQPEDVPNDRAREASGSSSGNTEEKDKEGEEGNRGDCIPMNNWGSGNGRGSGGGRGSSGQGSSSQGSGGRQGSGGGQGSGGQGAGGNQCSGNGQGTAGGHGSGGGGH
GSGGGQRPGDGHGSGGGKNSGSGKNSDDGDRGKSVKKRSYFGKFTQSKQQQTLPPPPPPPPAAGATGGKGKSGGRFRLYFCADRGTKERKEAKEVRDMETSGGATRGPYR
ARAFDEDEDDPYVPMRPGVAAPLACSSDYMPMAPQNSSASTKRHSRSPFEDSRGYMMMFPRVSPPPPVPSAPKAPDTNKGDDSKDNDSDSDYMFMAPGAGAIPKNPPNAQ
GGSSSKSWSSYFSLPSPFQSSPLGQSDHSEYVPMLPGKFLGSGLHKEASFSQGTKNVSSKPSTEASFSKPEDKGSSAKPSDDVPPMNKAKEPNHLSFIAKGTQVKPKPLN
PTQERREAAGSRDYINIDFIKRERLVLPSSAQGLPDMRGVVTDPAPTAFSGYLNVEFGVPFPNPTIRLSDLLRVLPGANSIPLAGTRWPFPGSAIGSIVEAGEYIEVIFN
PAMTPAMSFADSAICYDAQTGQIYVVDPFSECCMDVSLSPGRCSEPPPVARLRREEAQERRRPQSRSQSLFASTRAAVSAFPTDSLDRDFPAASAVIAAPAEAPLLAVSR
ALAVVSALAAAPSIGDVFAGFRAAAGVDSASARGFQPVAGAQAVREFQDLAAGWNPGALNHRARGEDLAAGAAAPPPPPRQIWVLRPQERADSEDDDDDDDDIYVRMDFA
RRDYRK*
63 >lcl|NP_034721.1|Plus1complement(5704250..5705254) NT_039280 transcription factor AP-1 Jun __SEG__ Chr4 {Mus musculus} MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGF
AEGFVRALAELHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPV
QHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQ
LQTF*
64 >lcl|NP_034722.1|Plus15894439..5895464 NT_039462 transcription factor jun-D Jund __SEG__ Chr8 {Mus musculus} METPFYGEEALSGLAAGASSVAGATGAPGGGGFAPPGRAFPGAPPTSSMLKKDALTLSLAEQGAAGLKPGSATAPSALRPDGAPDGLLASPDLGLLKLASPELERLIIQS
NGLVTTTPTSTQFLYPKVAASEEQEFAEGFVKALEDLHKQSQLGAATAATSGAPAPPAPADLAATPGATETPVYANLSSFAGGAGPPGGAATVAFAAEPVPFPPPPGALG
PPPPPHPPRLAALKDEPQTVPDVPSFGDSPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGC
QLLPQHQVPAY*
65 >lcl|NP_034788.1|Plus1complement(101232743..101233714) NT_039207 transcription factor MafB Mafb __SEG__ Chr2 {Mus musculus} MAAELSMGQELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEPKTHLEDLYWMASNYQQMNPEALNLTPEDAVEA
LIGSHPVPQPLQSFDGFRSAHHHHHHHHPHPHHGYPGAGVTHDDLGQHAHPHHHHHHQASPPPSSAASPAQQLPTSHPGPGPHATAAATAAGGNGSVEDRFSDDQLVSMS
VRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL*
66 >lcl|NP_034802.1|Plus123737040..23737276 NT_039625 keratin associated protein 6-1 Krtap6-1 __SEG__ Chr16 {Mus musculus} MCGYYGNYYGGRGYGCCGYGGLGYGYGGLGCGYGSYYGCGYRGLGCGYGYGCGYGSRSLYGCGYGCGSGYGSGFGYYY*
67 >lcl|NP_034803.2|Plus1complement(24124932..24125399) NT_039625 keratin-associated protein 6-2 Krtap6-2 __SEG__ Chr16 {Mus musculus} MCCNYYGNSCGYGCGYGSGYGCGSGSGYGCGYGSGYGCGYGSGYGCGSGSGYGCGYGSGYGCGYGSGYGCGYGSGYGCGYGSGYGCGYGSGYGCGYGSGYGCGYGSGYGC
GYGSGYGSGYGSGYGSGCGCGYGSYYRSGCCGYGPSCYRRCYSCC*
68 >lcl|NP_034806.2|Plus1complement(23601556..23601744) NT_039625 keratin-associated protein 8-2 Krtap8-2 __SEG__ Chr16 {Mus musculus} MSYYGSYYGGLGSGIRGFGNLGYGYGCGCGFGGYGYGSGYGRYGYGYRRPLYYGGYGFSRFY*
69 >lcl|NP_034930.1|Plus1319501..320094 NT_166302 class A basic helix-loop-helix protein 15 Bhlha15 __SEG__ Chr5 {Mus musculus} MKTKNRPPRRRTPMQDTEATPGEQTPDRPQSGSGGSELTKGLRSRTARASGGRGEVSRRRQGSGGRRENSVQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSK
IETLTLAKNYIKSLTATILTMSSSRLPGLEAPGPAPGPKLYQHYHHQQQQQQQQQQVAGAMLGVTEDQPQGHLQRYSTQIHSFREGS*
70 >lcl|NP_034980.2|Plus1complement(2044847..2046142) NT_039699 protein S-Myc Mycs __SEG__ ChrX {Mus musculus} MLSCTTSTMPGMICKNSDLEFDLLKPCFYPEEDDIYFGGHNSTPPGEDIWKKFELLPTPRLSPDSALAEHSLEPVNWATEMLLPEADLWSNPGEEEVFGQGGLRGCTSNP
IILQDCMWSGFSNPGKPESVVSEKLPGGYRSLAVGAGTLAPGAAAAASSAGHERSGTAGVGRGKAAWLTELSHLDLECVDPAVVFFPANKREPMPVPTIPTSTGSAISLG
DHQGLSSSLEDFLSNSGSVEEGGEEIYVVMLEETQFSKTVSRLPTAAHQENAALSPGCAQSSELILKRYDLIQEQHNYAAPPLPYVDREDARPQKKPRSHTSLALKCVFR
PKAPRLGSRNNSDWENIERRRNHNRMERQRRDIMRSSFLNLRDLVPELVHNEKAAKVVILKKATEYIHTLQADESKLLVERKKLYERQQQLLQKIKQYALC*
71 >lcl|NP_035024.1|Plus1complement(20335423..20336496) NT_039207 neurogenic differentiation factor 1 Neurod1 __SEG__ Chr2 {Mus musculus} MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDELEAMNAEEDSLRNGGEEEEEDEDLEEEEEEEEEEEDQKPKRRGPKKKKMTKARLERFKLRRMKANARE
RNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNPDMPPHLPTASASFPVHPYS
YQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGPQSHGSIFSSGAAAPRCEIP
IDNIMSFDSHSHHERVMSAQLNAIFHD*
72 >lcl|NP_035025.3|Plus1complement(9729574..9730725) NT_165773 neurogenic differentiation factor 2 Neurod2 __SEG__ Chr11 {Mus musculus} MLTRLFSEPGLLSDVPKFASWGDGDDDEPRSDKGDAPPQPPPAPGSGAPGPARAAKPVSLRGGEEIPEPTLAEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKR
KMTKARLERSKLRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQ
GADGAGRFHGSGGPFAMHPYPYPCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLSPPLCLNGNFSLKQDSSPDHEKSYHYSMHY
SALPGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPMYEELNAFFHN*
73 >lcl|NP_035026.1|Plus1complement(1893678..1894412) NT_039589 neurogenin-1 Neurog1 __SEG__ Chr13 {Mus musculus} MPAPLETCISDLDCSSSNSSSDLSSFLTDEEDCARLQPLASTSGLSVPARRSAPALSGASNVPGAQDEEQERRRRRGRARVRSEALLHSLRRSRRVKANDRERNRMHNLN
AALDALRSVLPSFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGGSARERLLPPQCVPCLPGPPSPASDTESWGSGAAASPCATVASPLSDPSSPSASEDFTYGPG
DPLFSFPGLPKDLLHTTPCFIPYH*
74 >lcl|NP_035046.1|Plus1complement(15885154..15885555) NT_039185 helix-loop-helix protein 1 Nhlh1 __SEG__ Chr1 {Mus musculus} MMLNSDTMELDLPPTHSETESGFSDCGGGPGPDGAGSGDPGVVQVRSSELGESGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKK
LSKIEILRLAICYISYLNHVLDV*
75 >lcl|NP_035271.1|Plus12250045..2251394 NT_109317 POU domain, class 3, transcription factor 1 Pou3f1 __SEG__ Chr4 {Mus musculus} MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGF
HARLVHQGAAHAGAAWAQGGTAHHLGPAMSPSPGAGGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGGAGPGLHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAGG
LHAAAAHLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDK
IAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPGGGQRVATFCAPATPAGRAAPPP
PPHTARLCAV
76 >lcl|NP_035300.1|Plus172803468..72804232 NT_039207 major prion protein precursor Prnp __SEG__ Chr2 {Mus musculus} MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKH
VAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKE
SQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG*
77 >lcl|NP_035351.1|Plus1complement(3374915..3375889) NT_039515 transcriptional activator protein Pur-beta Purb __SEG__ Chr11 {Mus musculus} MADGDSGSERGGGGGGGGGPGGFQPAPRGGGGGGGGPGGEQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIEHYAQLG
PSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTVNRGGGGFGGGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGDEDELAGGPGGGA
GGPGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMKEIQERQRDKLYERRGGGSGGGDESEGEEVDED*
78 >lcl|NP_035568.1|Plus1complement(93263792..93264736) NT_039207 transcription factor SOX-12 Sox12 __SEG__ Chr2 {Mus musculus} MVQQRGARAKRDGGPPPPGPGPAAEGAREPGWCKTPSGHIKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADYPDYKYR
PRKKSKGAPAKARPRPPGGGGGGSRLKPGPQLPGRGGRRASGGPLGGGAAAPEDDDEDEEEELLEVRLLETPGRELWRMVPAGRAARGPAERAQGPSGEGAAASAASPTL
SEDEEPEEEEEEAATAEEGEEETVVSGEEPLGFLSRMPPGPAGLDCSALDRDPDLLPPSGTSHFEFPDYCTPEVTEMIAGDWRSSSIADLVFTY*
79 >lcl|NP_035570.1|Plus1complement(19447211..19447933) NT_039476 transcription factor SOX-14 Sox14 __SEG__ Chr9 {Mus musculus} MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGL
PVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATSALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSASTLQPPVAYIL
FPGMTKTGIDPYSSAHATAM*
80 >lcl|NP_035573.3|Plus118888648..18889607 NT_162143 transcription factor SOX-2 Sox2 __SEG__ Chr3 {Mus musculus} MYNMMETELKPPGPQQASGGGGGGGNATAAATGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDY
KYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQEQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMN
GSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMAQHYQSGPVPGTAINGTLPLSHM*
81 >lcl|NP_035639.1|Plus1complement(23837076..23837429) NT_039492 transcription elongation factor SPT4 2 Gm3258 __SEG__ Chr10 {Mus musculus} MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGINAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKS
RDTAIKT*
82 >lcl|NP_035694.1|Plus1complement(1918381..1919568) NT_078925 sex-determining region Y protein Sry __SEG__ ChrY {Mus musculus} MEGHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKILHREKYPNYKYQPHRRAKVSQRSGILQPAVASTKLYNLLQWDRNPHA
ITYRQDWSRAAHLYSKNQQSFYWQPVDIPTGHLQQQQQQQQQQQFHNHHQQQQQFYDHHQQQQQQQQQQQQFHDHHQQKQQFHDHHQQQQQFHDHHHHHQEQQFHDHHQQ
QQQFHDHQQQQQQQQQQQFHDHHQQKQQFHDHHHHQQQQQFHDHQQQQQQFHDHQQQQHQFHDHPQQKQQFHDHPQQQQQFHDHHHQQQQKQQFHDHHQQKQQFHDHHQQ
KQQFHDHHQQQQQFHDHHQQQQQQQQQQQQQFHDQQLTYLLTADITGEHTPYQEHLSTALWLAVS*
83 >lcl|NP_035788.1|Plus131642843..31643463 NT_039548 twist-related protein 1 Twist1 __SEG__ Chr12 {Mus musculus} MMQDVSSSPVSPADDSLSNSEEEPDRQQPASGKRGARKRRSSRRSAGGSAGPGGATGGGIGGGDEPGSPAQGKRGKKSAGGGGGGGAGGGGGGGGGSSSGGGSPQSYEEL
QTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH*
84 >lcl|NP_036110.1|Plus1complement(27946756..27947634) NT_039413 zinc finger protein OZF Zfp146 __SEG__ Chr7 {Mus musculus} MSQLSQQRILSGGSPFACKVCGKLFSHKSNLTEHEHFHSREKPFECNECGKAFSQKQYVIKHQSTHSGEKLFECSDCGKAFSQKENLLTHQKIHTGEKPFECKDCGKAFI
QKSNLIRHQRTHTGEKPFICKECGKTFSGKSNLTEHEKIHIGEKPFKCNECGTAFGQKKYLIKHQNIHTGEKPYECNECGKAFSQRTSLIVHVRIHSGDKPYECNVCGKA
FSQSSSLTVHVRSHTGEKPYGCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQKSHHIRHQKIHTH*
85 >lcl|NP_036111.2|Plus127889696..27890919 NT_039413 zinc finger protein 260 Zfp260 __SEG__ Chr7 {Mus musculus} MLESLQPESHLLHDEPDPGESVYECNECKETFSLEQNFVEHKKTHSGEKSPECTGCGEESSQASSLTLHLRSRPRRESYKCGECGKAFSQRGNFLSHQKQHTEERPSESK
KTPVPMTTTVRNQRNTGNKPYACKECGKAFNGKSYLKEHEKIHTGEKPFECSQCGRAFSQKQYLIKHQNIHSGKKPFKCNECGKAFSQKENLIIHQRIHTGEKPYECKGC
GKAFIQKSSLIRHQRSHTGEKPYTCKECGKAFSGKSNLTEHEKIHIGEKPYKCNECGTIFRQKQYLIKHHNIHTGEKPYECNKCGKAFSRITSLIVHVRIHTGDKPYECK
ICGKAFCQSSSLTVHMRSHTGEKPYGCNECGKAFSQFSTLALHMRIHTGEKPYQCSECGKAFSQKSHHIRHQRIHIH*
86 >lcl|NP_036150.1|Plus118527910..18529037 NT_039476 forkhead box protein L2 Foxl2 __SEG__ Chr9 {Mus musculus} MMASYPEPEDTAGTLLAPESGRAVKEAEASPPSPGKGGGTTPEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIK
VPREGGGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAHFQPGKGLFGSGGAAGGCGVPGAGADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMPYASCQMAAAA
AAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGPYSRVQSMALPPGVVNSYNGLGGPPAAPPPPPPPPHPHPHPHAHHLHAAAAPPPAPPHHGAAAPPPGQLSPASPATAA
PPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLDL*
87 >lcl|NP_038547.2|Plus148473869..48475353 NT_078575 forkhead box protein C2 Foxc2 __SEG__ Chr8 {Mus musculus} MQARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYGAGMGRSYAPYHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRE
NKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVPKDKEERAHLKEPPSTTAKGAPTGTPVADGPKEAEKKVVVKSEAASPA
LPVITKVETLSPEGALQASPRSASSTPAGSPDGSLPEHHAAAPNGLPGFSVETIMTLRTSPPGGDLSPAAARAGLVVPPLALPYAAAPPAAYTQPCAQGLEAAGSAGYQC
SMRAMSLYTGAERPAHVCVPPALDEALSDHPSGPGSPLGALNLAAGQEGALGASGHHHQHHGHLHPQAPPPAPQPPPAPQPATQATSWYLNHGGDLSHLPGHTFATQQQT
FPNVREMFNSHRLGLDNSSLGESQVSNASCQLPYRATPSLYRHAAPYSYDCTKY*
88 >lcl|NP_038943.3|Plus121278361..21279929 NT_039185 zinc finger protein 238 isoform 2 Zfp238 __SEG__ Chr1 {Mus musculus} MEFPDHSRHLLQCLSEQRHQGFLCDCTVLVGDAQFRAHRAVLASCSMYFHLFYKDQLDKRDIVHLNSDIVTAPAFALLLEFMYEGKLQFKDLPIEDVLAAASYLHMYDIV
KVCKKKLKEKATTEADSTKKEEDASSCSDKVESLSDGSSHMAGDLPSDEDEGEDDKLNILPSKRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTE
SLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQVKVEKEASCDESDVGTNDYDMEHSTVKESVSTNNRVQYEPAHLAPLREDSVLRELDRED
KASDDEMMTPESERVQVEGGMENSLLPYVSNILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGIRSKPAADVNVPTCSLCGKTFSCMYTLKRHERTHSGEKPYTC
TQCGKSFQYSHNLSRHAVVHTREKPHACKWCERRFTQSGDLYRHIRKFHCELVNSLSVKSEALSLPTVRDWTLEDSSQELWK*
89 >lcl|NP_056573.1|Plus1complement(15048951..15049817) NT_039264 forkhead box protein E3 Foxe3 __SEG__ Chr4 {Mus musculus} MDAQVAFSGFPALPSLTPSGPQLPTLAGAEPGREPEEVVGGGDAEPTAVPGPGKRRRRPLQRGKPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQN
SIRHNLTLNDCFVKVPREPGNPGKGNYWTLDPAAADMFDNGSFLRRRKRFKRAELPAPPPPPPPFPYAPFPPPPAPASAPPARLFRLDSLLGLQPEPPGPVAPEPPCCAA
PDAAFPPCAAAASPPLYSPASERLGLPAPLPAQPLLALAGSAGALGPLGAGEAYLRQPGFAPGLERYL*
90 >lcl|NP_058560.1|Plus14894291..4894740 NT_039500 protein atonal homolog 7 Atoh7 __SEG__ Chr10 {Mus musculus} MKSACKPHGPPAGARGAPPCAGAAERAVSCAGPGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIIALTRILAEAERDWVGLRCE
QRGRDHPYLPFPGARLQVDPEPYGQRLFGFQPEPFPMAS*
91 >lcl|NP_058585.2|Plus187089304..87090869 NT_039207 insulinoma-associated protein 1 Insm1 __SEG__ Chr2 {Mus musculus} MPRGFLVKRSKKSTPVSYRVRGGEDSDRALLLSPGCGGARAEPPVPSPGPLPPPPPPALAERAHAALAAALACAPGPPPPPPPGPRAAHFGNPEAAHPAPLYSPTRPVSR
EHEKHKYFERSFNLGSPVSAESFPTPAALLAGGGSGANGAGGGGGGTCGGDALLFAPAELKMGTAFSAGAEAARGPGTGPPLSPAAALRPPGKRPAPPAAVATEPPAKAA
KAPSAKKPKAIRKLHFEDEVTTSPVLGLKIKEGPVEAPRGRAGGATRPLGEFICQLCKEEYADPFALAQHKCSRIVRVEYRCPECAKVFSCPANLASHRRWHKPRPVPAA
ARAPEPEAATRAEAREAAGGGSSDRDTPSPGGVSESGSEDGLYECHHCAKKFRRQAYLRKHLLAHHQALQAKGAPPPPPPPPPPAEDILAFYAGPDEKAPQEASGDGEAA
GVLGLSATAQCHLCPVCGETFPSKGAQERHLRLLHAAQVFPCKYCPATFYSSPGLTRHINKCHPSENRQVILLQVPVRPAC*
92 >lcl|NP_058663.2|Plus125931722..25932693 NT_039625 oligodendrocyte transcription factor 2 Olig2 __SEG__ Chr16 {Mus musculus} MDSDASLVSSRPSSPEPDDLFLPARSKGGSSSGFTGGTVSSSTPSDCPPELSSELRGAMGASGAHPGDKLGGGGFKSSSSSTSSSTSSAATSSTKKDKKQMTEPELQQLR
LKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPTATAHPAAAAHAAHHPAVHHP
ILPPAAAAAAAAAAAAAVSSASLPGSGLSSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGGSGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGTLPRLTSDAK*
93 >lcl|NP_058664.2|Plus125975199..25975981 NT_039625 oligodendrocyte transcription factor 1 Olig1 __SEG__ Chr16 {Mus musculus} MYYAISQARVNAAPATMLRPQRPGDVQLGASLYELVGYRQPPISSSSSSSSSTASLLPKPAREKAEAPLAEPRGPAPESGGARADAKEEQQQQQLRRKINSRERKRMQDL
NLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGDGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPETLRPTKYLSLALDEPPCGQ
FSLPAGGAGSPGLCSCAVCKFPHLVPAGLGLAAVQAQFSK*
94 >lcl|NP_059069.1|Plus1complement(13219911..13221299) NT_039580 nuclear factor interleukin-3-regulated protein Nfil3 __SEG__ Chr13 {Mus musculus} MQLRKMQTIKKEPAPLDPTSSSDKMLLLNSALAEVAEDLASGEDLLLNEGSMGKNKSSACRRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGE
ENATLKAELLSLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKAAVSSFVDEHEPAMVAGSCISVIKHSPQSSLSDVSEVSSVEHTQESPAQGGCRSPENKFPVIKQ
EPVELESFAREAREERGTYSTSIYQSYMGSSFSTYSHSPPLLQVHGSTSNSPRTSEADEGVVGKSSDGEDEQQVPKGPIHSPVELQRVHATVVKVPEVNPSALPHKLRIK
AKAMQVKVEALDSEFEGMQKLSSPADAIAKRHFDLEKHGTSGMAHSSLPPFSVQVTNIQDWSLKSEHWHHKELSSKTQSSFKTGVVEVKDGGYKVSEAENLYLKQGIANL
SAEVVSLKRFIATQPISASDSR*
95 >lcl|NP_062417.1|Plus1complement(8215188..8215754) NT_039548 mesogenin-1 Msgn1 __SEG__ Chr12 {Mus musculus} MDNLGETFLSLEDGLDSSDTAGLLASWDWKSRARPLELVQESPTQSLSPAPSLESYSEVALPCGHSGASTGGSDGYGSHEAAGLVELDYSMLAFQPPYLHTAGGLKGQKG
SKVKMSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTDLLNSSGREPRPQSV*
96 >lcl|NP_062742.4|Plus1complement(10831708..10832574) NT_039716 mortality factor 4-like protein 2 Morf4l2 __SEG__ ChrX {Mus musculus} MSSRKQASQTRGQQSAEEDNFKKPTRSNMQRSKMRGAASGKKSAGSQPKNLDPALPGRWGGRSAENPPSGSVRKTRKNKQKAPGNGDGGSTSEVPQPPRKKRARADPTVE
SEEAFKSRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVGGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMS
QIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASADYHRKAL*
97 >lcl|NP_064435.1|Plus1complement(27471267..27471791) NT_039433 achaete-scute homolog 3 Ascl3 __SEG__ Chr7 {Mus musculus} MDTRSYPSPPDRLSVFAESAHLPLSRPFYLDPMVTVHLCPETPVPASYTDELPLLPFSSDTLIMNNYGDPYPFPFPMPYTNYRRCDYTYGPAFIRKRNERERQRVKCVNE
GYARLRRHLPEDYLEKRLSKVETLRAAIKYISYLQSLLYPDESETKKNPRTASCGSLDPALRVI*
98 >lcl|NP_064683.2|Plus114025674..14027155 NT_039551 insulinoma-associated protein 2 Insm2 __SEG__ Chr12 {Mus musculus} MPRGFLVKRTKRSGSSYRARPVEPLFPPPGPLAAQSSPEEPGRGLLGSPCLAPPQDDAEWGAGGGDGPGPSPARPAGPELRRAFLERCLRSPVSAESFPSATAFCSAAPA
AVTSGEELVPPQVPVSVPIPVPGPAPHGLQRRGKGAPVCASAPAAVRKPKAVRRLSFADEVTTSPVLGLKIKEEEPGAPARALGGVRTPLGEFICQLCKHQYADPFALAQ
HRCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPRPTPACAASKPPHAPLTPPDPSLATGKENGRVPRTDDQHPQAPDSSGDGQHRDSAARPGLQALVYPEAARPQAPY
PEVILGRHGPGSSGASAGATSEVFVCPYCHKKFRRQAYLRKHLGTHETGSARAPTPGFGSERTAPLTFACPLCGAHFPSADIREKHRLWHAVREELLLPALVGAPSEAGP
GGASDGSAQQIFSCKYCPSTFFSSPGLTRHINKCHPSESRQVLLLQMPLRPGC*
99 >lcl|NP_067488.1|Plus133212615..33213532 NT_078575 THAP domain-containing protein 11 Thap11 __SEG__ Chr8 {Mus musculus} MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQ
QQQQQQQQLQQQQPSPSSSTAQTTQLQPNLVSASAAVLLTLQAAVDSNQAPGSVVPVSTTPSGDDVKPIDLTVQVEFAAAEGAAAAAAASELEAATAGLEAAECTLGPQL
VVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRLLAMAVIRKKHGM*
100 >lcl|NP_067535.3|Plus12294098..2295165 NT_162143 class E basic helix-loop-helix protein 22 Bhlhe22 __SEG__ Chr3 {Mus musculus} MERGLHLGAAAASEDDLFLHKSLGTSAAKRLEAAFRSTPPGMDLSLAPPTRERPASSSSPLGCFEPADPEGAGLLLPPPGGGGGASGGGGGVSVPGLLVGSAGVGGEPSL
SSLPAGAALCLKYGESAGRGSVAESSGGEQSPDDDSDGRCELVLRAGGPDPRASPGAGGGSAKVAEGCSNAHLHGGSGLPPGGPTSGGGSGGGGGGSSKKSKEQKALRLN
INARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALEEMRRLVAYLNQGQAISAASLPSSAAAAAAAAALHPALGAYEQAAGYPFSAGLPPA
ASCPEKCALFNSVSSSLCKQCTEKP*
101 >lcl|NP_071773.2|Plus1complement(16027660..16028637) NT_039474 forkhead box protein B1 Foxb1 __SEG__ Chr9 {Mus musculus} MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK
VLKSDHLAPSKPADAAQYLQQQAKLRLSALAASGTHLPQMPAAAYNLGGVAQPSGFKHPFAIENIIAREYKMPGGLAFSAMQPVPAAYPLPNQLTTMGSSLGTGWPHVYG
SAGMIDSATPISMTSGDYSAYGVPLKPLCHAAGQTLPAIPVPIKPTPAAVPALPALPAPIPTLLSNSPPSLSPTSSQTATSQSSPATPSETLTSPASALHSVAVH*
102 >lcl|NP_077787.3|Plus1complement(22685082..22686827) NT_078575 zinc finger protein 319 Zfp319 __SEG__ Chr8 {Mus musculus} MSESWQQPPQTQPQQPQAPQPQHHAETPPALAEHTLPPGSAENPLGCAVYGILLQPDPGLQPPQHAPLQAGEPGPKCGVCGHDLAHLSSPHEHQCLAGHDRSFQCTQCLK
IFHQATDLLEHQCVQAEQKPFVCGVCKMGFSLLTSLAQHHSSHTGMVKCSICDKTYKPAEAAEPATTTAPSLPSAPPPANIAPVEQPEKPYSCPVCQKPFKHLSELSRHE
RIHTGEKPYKCTLCDKSFSQSSHLVHHKRTHSSERPYKCAVCEKTFKHRSHLVRHMYAHSGEHHLFRCNVCELHFKESSELLQHPCTPSGERPFRCGECQKAFKRPSDLR
QHERTHSAERPFKCDLCPMGFKQQYALMRHRRTHKTEEPFKCGLCEKGFGQPSHLLYHQHVHTLETLFKCPVCQKGFDQSAELLRHKCLPTSTERPFKCPVCNKAYKRAS
ALQKHQLSHCAAAEKPLRCTLCERRFFSSSEFVQHRCDPAREKPLKCPDCEKRFKYASDLQRHRRVHTGEKPYKCPSCDKAFKQREHLNKHQGVHAREQQFKCVWCGERF
LDVALLQEHSAQHSAAAAAAEGAYQVAACLP*
103 >lcl|NP_079600.1|Plus11969077..1970042 NT_039413 zinc finger protein 524 Zfp524 __SEG__ Chr7 {Mus musculus} MDNPSSDPLPSTLSGEEEKPLALLPPVPRGRRGRPPGGATTSNRTLKSSLPRKRGRPPRSEQETPLTAPVDSGGSSDLLLIDDQGVPYTVPEGSAADGPQGSGSKRAPHF
CPVCLRAFPYLSDLERHSISHSELKPHVCKDCGKTFKRSSHLRRHCNIHAGLRPFRCVLCPRRFREAGELAHHHRIHSGERPYQCPSCRVRFTEANTLRRHYKRKHPELV
GMPVRLCPPNPRTQPLWDDDEGIPVQEGVQEESPEGKEPTWPISSTTSPLSGFTAGGSAGAGRGQEGQDTLVSGGIPTMEGDQKQGPKPLGPGAIGHPPVD*
104 >lcl|NP_079696.1|Plus1complement(42204355..42204903) NT_039240 small proline rich-like 10 Lce1m __SEG__ Chr3 {Mus musculus} MSCQQSQQQCQPPPKCKTPKCPPTSSCCSLGSGGCCGSSSGGCCSSGCGGCCLSHHKPRFSLRRRRHSSGCCSSGGSSCCGSSGGSSCCGSSGGSSGGSSGGSSGGSSCC
GSSGGSSGGSSCCGSSSGGSSCCGSSSGGSSGGSSGGSSCCGSSGGSSGGSSSGSNSHQQSGGSSCCSGGCC*
105 >lcl|NP_079702.3|Plus111758960..11759661 NT_096135 mediator of RNA polymerase II transcription subunit 7 Med7 __SEG__ Chr11 {Mus musculus} MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLE
DLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKAEPMDTDDNSNCPGQNEQQRESSGHRRDQIIEKDA
ALCVLIDEMNERP*
106 >lcl|NP_080322.2|Plus1complement(10395376..10396944) NT_039413 zinc finger protein 329 Zfp329 __SEG__ Chr7 {Mus musculus} MEGFTREAPCFPILGDNWDCENQERNLRQSPLIDEKTEAQEANCGHVNLGEHLSTNPALLPSQRVPGTNGFHVFNSDIKTFDCDQTLHSCPPSYAVKGTADGDACEKATQ
PSMEATQLVRNQMREKSYKYTESVKSLNHFTTALCDKKIKKRSKRFYKGKDFGDILALSSSLNEKRSHSAEKPYKCAECGKCFKRNSSLVLHHRTHTGEKPYTCNDCGKS
FSKNYNLIVHRRIHTGEKPYKCSKCGKAFSDGSALTQHQRIHTGEKPYACLDCGKTFNRNSSLILHQRTHTGEKPYRCNECGKPFTDISHLTVHLRIHTGEKPYECSRCG
KAFRDGSYLTQHERTHTGEKPFECVECGKSFSRNSHLIVHQKIHSGEKPYECKECGKTFIESAYLIRHQRVHTGEKPYGCNQCRKLFRNIAGLIRHQRIHTGERPYECNQ
CGKAFRDSSCLTKHQRIHTKETPYQCLKCGKSFRQNTHLVVHQRLHNREGPSQCPHCGKIFRRSWCLARHQRTHLEEQPTET*
107 >lcl|NP_080333.1|Plus1complement(68889303..68890016) NT_039353 zinc finger protein 22 Zfp422 __SEG__ Chr6 {Mus musculus} MRLGKPKGGISRSASQGKAYESKRKTARQRQKWGVAIRFDSGLSRRRRNVDEKPYKCAKCSKSFSQSSTLFQHKKIHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKP
YKCDECGERFKQSSNLIQHQRIHTGEKPYCCDECGRCFSQSSHLIQHQRTHTGEKPYQCEECDKCFSQSSHLRQHMKVHKEKKPHKRGKNARVKTHPVSWKRGKGRKAVA
GIRQVKGATSGLFKKKK*
108 >lcl|NP_080928.1|Plus110462056..10464107 NT_109315 hypothetical protein LOC68274 4930547C10Rik __SEG__ Chr4 {Mus musculus} MAIELSSKCECPSCAEGSPSESDWNYSSGKRGDGASYSRLTKKSTISPIMQRFLSQCCSNELGSTNKEDFTFLASEEESSVDFSQTQNLSQTSKKTRSLRELTIQELLSK
FGDNERLPPHSVSLSHFRDHVVVKFRRALYYSGIWVKYVQGSGLKRFFSAHYFKRNPSSLHRLIPWLKRELTAICGDYGYTVKNILTAILHHMTKFNLNSEAFTHLLEPY
LFQYTQHFLHEFISFVDSSYNMETYDRNAIYQCPVSKSSKKKSTVSAPAFSFPQELSFMKSQRGIKQSKKTWNKTGQSSDSGLKQFPKGHSSKNPQISTTHQKPANKRHV
WTKDEWGSDDFRGVVCTTNSLNWAYLRARRLDKEYYRNDNREKKSESTKLPPGHVQDLKSHETSPNIFRALVDSNQAPPKKYNIRETNVLDPGQQVHYQKKETERKKLEE
SSLKALQRLPKERILIKSKSRESNHSCLCVSENSTSPTRNDKMLTSISKKMVRCSQSSQCVEVGSHHSRRTQRQYSPRTPRSKSWCVRIRKQSMSRGQSNLSLRESHRSK
HCALSKGSAHGCESTYRVASLSPVHHDQVCLTAGKNCKCASMGEGESQTGGHCDSLSCLKTEKCHSPSKLGMKGKHLVGRVTRIRTHRRKKPKYQCVGTQTTAEFRDDLG
DLEDKSQKGFLNSHPECVTSCRR*
109 >lcl|NP_081017.1|Plus1complement(1944824..1946512) NT_039413 zinc finger protein 579 Zfp579 __SEG__ Chr7 {Mus musculus} MDPQPPPPAQGSPPHRDRGRGRGRGRGRGRGRGRGRGGAGAPRAPLPCPTCGRLFRFPYYLSRHRLSHSGLRPHACPLCPKAFRRPAHLSRHLRGHGPQPPLRCAACPRT
FPEPAQLRRHLAQEHAGSEVDLSTQRAVKEEPEASWGPQDEGVEQPATVVVAGAEEEATTQWPAGDSAPAAVPTSTDPRESEAKEAEAGAAELRAELALAAGRQEEKQVL
LQADWTLLCLRCREAFATKGELKAHPCLRPEGEQEGEGGPPPRPKRHQCSICLKAFARPWSLSRHRLVHSTDRPFVCPDCGLAFRLASYLRQHRRVHGPLSLLAPLPGAG
KKDDKASGGRNSGKGPEGGEGAECGGASEGGEGGHNGGDATPARPPAGEPRFWCPECGKGFRRRAHLRQHGVTHSGARPFQCVRCQREFKRLADLARHAQVHAGGPAPHP
CPRCPRRFSRAYSLLRHQRCHRAELERAELERAAALQELQTQASQSPQPPQPLKQEAEGLPLPIAHIKEEPPSPGTPPQSPPAPPVFLSASCFDSQDHSAFEMEDEEMDS
KAHLCGLGGLAS*
110 >lcl|NP_081176.1|Plus12004419..2004937 NT_039413 zinc finger protein 580 Zfp580 __SEG__ Chr7 {Mus musculus} MLLLPPRPPHPRSSSPEVMDPPPPKTPPFPKAEGPSSTSSSVAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQREATPGEPGPRKGYSCPECARVFASPLRLQSH
RVSHSDLKPFTCGACGKAFKRSSHLSRHRATHRARAGPPHTCPLCPRRFQDAAELAQHVRLH*
111 >lcl|NP_081192.2|Plus163876..64184 NT_039314 hypothetical protein LOC69034 4930579G22Rik __SEG__ Chr5 {Mus musculus} MDPPTRPSVSGPRTRARPPPPEALPTVGFEEEVYDCLDYYYLRDFPASGAGRSKGRTRREQQLRTNYPVPGGHERKVAQILLNGQRKRRQRQLQPRPRTRLA*
112 >lcl|NP_081415.1|Plus18633655..8634449 NT_039590 transcription initiation factor TFIID subunit 9 isoform 1 Taf9 __SEG__ Chr13 {Mus musculus} MESGKMASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPY
SGPRLPPDRYCLTAPNYRLKSLQKKAPAPAGRITVPRLSVGSVSSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPASQSPAVKASIPATSTVQNVLINPSLIG
SKNILITTNMVSQNTAESANALKRKREDDDDDDDDDDDDDYDNM*
113 >lcl|NP_081671.1|Plus1complement(16309456..16310136) NT_039618 brain acid soluble protein 1 Basp1 __SEG__ Chr15 {Mus musculus} MGGKLSKKKKGYNVNDEKAKDKDKKAEGAGTEEEGTPKESEPQAAADATEVKESTEEKPKDAADGEAKAEEKEADKAAAAKEEAPKAEPEKSEGAAEEQPEPAPAPEQEA
AAPGPAAGGEAPKAGEASAESTGAADGAAPEEGEAKKTEAPAAAGPEAKSDAAPAASDSKPSSAEPAPSSKETPAASEAPSSAAKAPAPAAPAAAEPQAEAPAAAASSEQ
SVAVKE*
114 >lcl|NP_081937.1|Plus1complement(34219693..34220871) NT_039170 heat shock transcription factor, Y-linked Hsfy2 __SEG__ Chr1 {Mus musculus} MAEAPSEMQAVSPNSLSTDLETSSGEPWCDNTGQKDSDLWAIIEESAFQVLAQRFLIKRPPHTLCASEPDEDSNLFSMTFPRKLWKIVGSDKFKSIWWDEDGTYIVINEE
LFKKEVLERKAPFRIFETDSMKSLVRQLNLYGFRKMRQNFQRSASLPDFLAEEKGISASCKLQFYQNPNFLRDCPHLIERMKRRIGIKTVSRGAAPSLPDFKNKHFRPDL
VKMDDHSLGVAVQTSERNLLSSSSISNVYLRQKPSLAQGGSDTMDVIRSDFSLATPSSFRPPEEILTHRPAPLNEVSSLCMDSQRIFTQANDSTVNFIITSITQNRGDMS
HLWNSCIEMQGEPSFQPGFPHFSSSSSTYSDSKAKGEPELPIHKERVASTTLASTSNHHSSS*
115 >lcl|NP_082833.1|Plus15071502..5072062 NT_039472 methyl-CpG-binding domain protein 3-like 1 Mbd3l1 __SEG__ Chr9 {Mus musculus} MGKTSQRKQCDCENPSKPCLSTSIPLRMSSYTFKRPVTKITSHLGNEVRYYQWEETLEKPEQACWQKRLQGLQAYSSAGELLSTSDLAKTLKDLTSTDTVASASDTQATS
IDITSVPTLESSSHLANMIPEAGPQILCKEFLVTEQDIINQERKVKIARERLAVALIAHKLASEMETVRGSRKANL*
116 >lcl|NP_082897.2|Plus1complement(24108688..24109074) NT_039625 keratin-associated protein 16-7 Krtap16-7 __SEG__ Chr16 {Mus musculus} MCCNYYGNSCGGCGYGSRYGYGCGYGSGYGCGYGSGYGCGYGSGYGCGYGSGYGCGYGSGYGCGYGSGYGCGYGSSYGCGYGSGYGCGYGSGYGCGYGSGYGCGYGSRYG
CGYGSGCCSYRKCYSSCC*
117 >lcl|NP_083108.1|Plus1complement(26913733..26914890) NT_039500 mTERF domain-containing protein 3, mitochondrial precursor Mterfd3 __SEG__ Chr10 {Mus musculus} MPWRLPTGHQLCRLCLLRKPRPALKIKPSSACVTYGTDSQSDKENKRTVEKLSACSVDIRKIRRLKGWVLLEEETYVEEIANILKELGANKTVIASILERCPEAIICSPA
AVNTKRKLWQMVCKNEAELVQLIEQFPESFFTVKNQENQKLNVQFFQELGLRNVVISRFLTTASSIFHNPVENNKQMIGVLQESYLNLGGSEANAKVWLLKLLSQNPFIV
LHSPRAVGETLKCLQGQGFTDSEVLQLLSKLKGFLFQLQPGSIQNSISFTKTTFECTDYDLRQLVVKCPALLCYPASVLEERIQALLKEGISIAQIRESPMVLELTPQII
QYRIRKLNSLGYGIKDGHLASLNGTKKEFEANFSKMQAKQGRPLFNPVASLKVEE*
118 >lcl|NP_083591.1|Plus123705321..23706310 NT_039589 POU domain, class 5, transcription factor 2 Pou5f2 __SEG__ Chr13 {Mus musculus} MAGRRSSNVFPLSGNSGGGLEVDTPTWLSSQAATSRLMVRPSMGPGICPGPEVWGVPLGSSPYEFRGGIAPYRACEARAWSQSSSEDTCPGPYIALRYMPNLALPEDVSA
IQKEMEQLAKELRQKRMTLGYSQADVGFAVGAMFGKVLSQTTICRFEAQQLSLANMWKLRPLLKMWLEEVDEKNLLGICRMEMILEQARKRRRASRERRIGSNLEKLFLQ
CPEPTPQQISYIAGRLRLQKDLVQVWFSNRSQMGSWPTNDTSRREDVGATGSPFPGPPVCFPMAPGLHFDFPHYEGSCLTPLYSSTPFPVRGALLSAPTTTLGLPRLSS*
119 >lcl|NP_083807.2|Plus14931..6787 NT_078572 zinc finger protein 60 Zfp60 __SEG__ Chr7 {Mus musculus} GLETGFEAENRSPKNHVYNKKLPKQTIQQLSKTSDVQGVSVSNGPGYSVIKEPQNYQEGDANRNITNKKEMSTYTSKTLAHNKEKPYKCKDCGKCFGCKSNLHQHESIHT
GEKPYECKDCGKTFRLPQMLSRHQKSHSDERPFECNICGKSFHLPTLLQYHKNIHTGLKPFECEECGKSFNRISTLFQHRTIHAGMKPYKCNVCGKAFNRRSNLLQHQKI
HSEDRPFHCKVCGKAFTVLAQLTRHENIHTEDKSFECKQCGKIFSNGSYLLRHYDTHTNEKPFECNICGKAFRLHLYLSEHQKTHTDEKPFKCKLCESAFRRKYQLSEHQ
RIHTDVKPYQCKDCGKFFRRRSNFTEHQSIHTGKKPFECKDCGKVFRLNIHLIRHQRFHSDEKPFECKECGKAFHFSSQLNNHKTSHTGQTPFECKECGKSFKRVSSLVE
HRIIHSGVKPYKCNACGRAFNRRSNLMQHEKIHSDERPFECKDCGKAFTVLAQLTRHQTIHNGKKSYECEQCGSAFRLPYQLTQHQRIHYDVKPFQCKECGKGFVRSTGL
RIHERIHTGEKPFQCKECGEAFQYHYQFLGHFRIHTGKNPYECSECGKYFTYGRDLKVHQSIHNLEKP*
120 >lcl|NP_084475.1|Plus137063631..37065130 NT_039621 zinc finger protein 623 Zfp623 __SEG__ Chr15 {Mus musculus} MMSDELTVLEPSASESREFHEDRLAQLLGNPDKQSLESPSSQDGGFTQMTVTHWKIQTGDTAQTCSKSGRNPILNSNLLILQRELIDAEARSCGGGGKGFPFNSDVVPHQ
ISHTGEKPYKCDHCGKGFSQTSLLTEHQRVHTGDRLCVCHVCGKDFVHYASLREHQHVHTGEKPFKCAQCGKAFCHSSDLLRHQRVHTRERPFECKECGKGFSQSSLLIR
HQRIHTGERPYECNECGKSFIRSSSLIRHYQIHTEVKQYECRDCGKAFRHRSDLIEHQRIHTGERPFECQECGKAFIRSSKLIQHQRIHTGERPYVCNECGKRFSQTSNF
TQHQRIHSGEKLYECNECGKAFFLSSYLIRHQKIHTGERVYECKECGKAFLQKAHLTEHQKIHTGDRPFECKDCGKAFIQSSKLLLHQIVHTGEKPYVCSYCGKGFIQRS
NFLQHQKMHTEEKRYTYSQLGKDLTPPPDLVHQEDLSLSETSVHLGERSTDRECCGNNL*
121 >lcl|NP_112460.1|Plus18423852..8424982 NT_165773 transcription factor Sp6 Sp6 __SEG__ Chr11 {Mus musculus} MLTAVCGSLGSQHTDAPHASPPRLDLQPLQTYQGHTSPEAGDYPSPLQPGELQSLPLGPEVDFSQGYELPGASSRVTCEDLESDSPLAPGPFSKLLQPDMSHHYESWFRP
THPGTEDGSWWDLHPGTSWMDLPHTQGALTSPGHPGALQPALGGYVGDHQLCAPPPHPHPHHLLPAAGGQHLLGPPDGAKALEAAAQESQGLDSSLDAASRPKGSRRSVP
RSSGQTVCRCPNCLEAERLGAPCGPDGGKKKHLHNCHIPGCGKAYAKTSHLKAHLRWHSGDRPFVCNWLFCGKRFTRSDELQRHLQTHTGTKKFPCAVCSRVFMRSDHLA
KHMKTHEGAKEEAAAAAQGEGKAGGVVEPPGGKGKREAEGSSASSN*
122 >lcl|NP_277057.1|Plus131613355..31613861 NT_039548 fer3-like protein Ferd3l __SEG__ Chr12 {Mus musculus} MAAYPESCLDATVLNFVADLSLASPRHPLLCEFPPGVPFGDRTLGYREGRPGRLSQFDERYQEVEGDEVEYEDPEEEEEEGEGRGRVASLLGRPKRKRVITYAQRQAANI
RERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLQSKEEKEAS*
123 >lcl|NP_443734.2|Plus111779893..11780714 NT_039492 oligodendrocyte transcription factor 3 Olig3 __SEG__ Chr10 {Mus musculus} MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHHQESRLNSVSSTQGDMVQKMPGESLSRAGAKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREV
MPYAHGPSVRKLSKIATLLLARNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANAVHPVHPILGGALSSGNASSPLSATSLPTIGTIRPPHSLLKAP
STPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK*
124 >lcl|NP_444354.2|Plus1complement(157807..160227) NT_166299 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 Smarca5 __SEG__ Chr4 {Mus musculus} NSRDGYQHLGLFA**EMKSKELYLSGMFYYQESGMCVSHLMKCLLKRKSVFKKIQLEILSYR*SSQDKKMKKI*VVRNSERIQDYKSAVANRDASSEQPA*ALVTSKLFV
TRCV*FS**L*FLV*YK*LPWGSKAS*EASYGFVSIPPSSN*S*C*KEFASKKGSKNLCGS*QNAKRMVYSDINKDIDMLNSAGKMDKMRLLNILMQLRKCCNHPYLFDG
AEPGPLYTTDTHLVTNSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDEQKPHDERQDSINAYNEPNSTKFVFMLSTGAGGLGINLATADVVI
LYDSYWNPQVDLQPMDHAHRIGQRKTVRVFRFITDNTVEERIVECAEMKLRLDSIVIQQGRLVDQNLNKIGKDEMLQMIRRGATHVFASKESEITDEDIDGILERGAKKT
AEMNEKLSKMGESSLRNFTMDTESSVYNFEGEDYREKQKSAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAP*PPKQLNVQDFQFFPPGLCELLEKEILYYRKT
IGYKVPWSPDLPNAAQA*KEQLKIDEAEPLNDEELEEKEKLLTQGFTNWN*RDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEY*AVFWERCNELQDIEKIMAQIER
GEARIQRRISIKRALDTKIGWYKAPFHQLRISYGTNK*KNYSEEEDRFLICMLPKLGFDKENVYDEL*QCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERESMELE
EKEKAEKKKRGPKPSTQKRKMDGALDGRGRKKKLKL*
125 >lcl|NP_536709.2|Plus1495420..497135 NT_039455 zinc finger protein 358 Zfp358 __SEG__ Chr8 {Mus musculus} MRRSVLVRNPGHKNLRPLYGDLHSDPEDLDSSPKDPDPISESPEPEPEDLNTVSEDGDASLEDLDPEADEAPRSILGKPDLDSQDLDPMSSSFDLDPDPDVIGPVPLVLD
PSNDTPSPAAPDVDSLPSGLTATPEILATSPAVLPAPASPPRPFSCPDCGRAFRRSSGLSQHRRTHSGEKPYRCPDCGKSFSHGATLAQHRGIHTGARPYQCAACGKAFG
WRSTLLKHRSSHSGEKPHHCPVCGKAFGHGSLLAQHLRTHGGPRPHKCPVCAKGFGQGSALLKHLRTHTGERPYPCPQCGKAFGQSSALLQHQRTHTAERPYRCPHCGKA
FGQSSNLQHHLRIHTGERPYACPHCSKAFGQSSALLQHLHVHSGERPYRCQLCGKAFGQASSLTKHKRVHEGAAAAAAAAAAAAAAAAAAAGLGLGSGLSPVSMMRPGQI
SFLGPDAVSVLESGLGLSSGASSARSSAPTSVLGSLQNPILQTHSGSISSPDLVLSSDPKPGHVADPDVVPSPDQESDPSPNPDLVPSPDPKPKSQTDPCSPTHDSSSPA
LPTGESPKWVKEEGALLGPDG*
126 >lcl|NP_542372.2|Plus1complement(3061985..3062656) NT_039212 class E basic helix-loop-helix protein 23 Bhlhe23 __SEG__ Chr2 {Mus musculus} MAELKSLSGDSYLALSHSYTATGHAYAAARGPETTRGFGASGPGGDLPAAPASRVPAATVESSGEQSGDEDEAFERRRRRRGSGVAVDARRRPREQRSLRLSINARERRR
MHDLNDALDGLRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALEEMRRLVAYLNQGQGLAAPVAAAPLTPFGQAAIYPFSAGTALGPCPDKCATFSGSPSALCKHCG
EKP*
127 >lcl|NP_570926.1|Plus1complement(23752929..23753165) NT_039625 keratin-associated protein 16-8 Krtap16-8 __SEG__ Chr16 {Mus musculus} MCGYYGNYYGGRGYGCCGCGGLGYGYGGLGCGYGSYYGCGYRGLGCGYGYGCGYGSRSLYGCGYGCGSGYGSGFGYYY*
128 >lcl|NP_570927.1|Plus1complement(23583041..23583304) NT_039625 keratin-associated protein 16-5 Krtap16-5 __SEG__ Chr16 {Mus musculus} MSHYSSYYGGLGYGYGSFGGPGCGCNSIRRLVGFGSGYGGFGYGSGFGGFGYGSGYGGYGYGSGFRGYGCGCRRPSCCGGYGFSSFY*
129 >lcl|NP_570940.1|Plus1complement(23579152..23579577) NT_039625 keratin-associated protein 16-1 Krtap16-1 __SEG__ Chr16 {Mus musculus} MSYYSGYSGGLGYGYGSSFGGLGCGCNSIRRLGCGSGYGGFGYGSGYGGFGGFGYGSGYGGYGYGSGYGGFGGFGYGSGYGGFGYGSGYGGFGGFGYGSGYGGYGYGSGF
GGYGYGSGFRGYGCGCRRSSCCGGYGFSSFY*
130 >lcl|NP_570943.1|Plus1complement(23590134..23590388) NT_039625 keratin-associated protein 16-4 Krtap16-4 __SEG__ Chr16 {Mus musculus} MSYYNSYYGGLGYGSGGYGGLGYGYGCGCGSFRRLGYGCGFGGYGGFGYGSGYGGFSSGSGYGGFGYGYRRPLSYGGYGFSTFY*
131 >lcl|NP_570946.2|Plus1complement(23574456..23574719) NT_039625 keratin-associated protein 16-9 Krtap16-9 __SEG__ Chr16 {Mus musculus} MSYYSGYYGGLGYGYGSSFGGLGCGCNSIRRLGCGSGYGGFGYGSGYGGYGYGSDYGGYGYGSSYGGYGCGCRRPSCCGRYGFSNFY*
132 >lcl|NP_579937.1|Plus1complement(23637357..23637533) NT_039625 keratin-associated protein 16-10-like AY026312 __SEG__ Chr16 {Mus musculus} MSYYYGNYYGGLGYGLGGFGGFGGLGYGYGSSYGLGGYGGYGYFSPSFYGGYLSSGFY*
133 >lcl|NP_598764.1|Plus1complement(70312622..70313929) NT_039500 zinc finger CCCH domain-containing protein 10 Zc3h10 __SEG__ Chr10 {Mus musculus} MPDRDSYANGTGSSGGGPGGGGSEEASGAGTGSGGATSDAICRDFLRNVCKRGKRCRYRHPDMSEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGE
LPPRLRQKVAAGLGLSPADLPNGKEEVPICRDFLKGDCQRGAKCKFRHLQRDFEFDARGGGGTGGGGSTGSAPPGRRHDLYDIYDLPERGFEDHEPGPKRRRGGCCPPDG
PHFESYECNLAPLRGVECRLLEEENALLRKRVEELKKQVSNLLATNEVLLEQNAQFRNQAKVMTLSSTAPATEQTLAPTVGTVATFNHGIAQTHTTLSSQALQPRPVSQQ
ELVAPTGAPAAPPTNAAPPAAPPPPPPHLNPEITPLSAALAQTIAQGMAPPPVSMAPVAVSVAPVAPVAVSMAQPLAGITMSHTTTPMVTYPIASQSMRITAMPH*
134 >lcl|NP_660133.2|Plus18191692..8192768 NT_039433 CREB/ATF bZIP transcription factor Crebzf __SEG__ Chr7 {Mus musculus} MRHSLTKLLAASGRDFPSRRDSREPPATRAPPREPSGAAAGAETPRPGSPDREQPHGDGDGGEPEARSGSRGSVAVRAPAPSPLKMEEEEEDAIAMVPKEEPEDMDFLSG
LELADLLDPRQPDWHLEPGLSSPGPLSSSGGGSESGGLLRGDDDDDTAAAEMQRFSDLLQRLLNGIGGCSSGGDRGGGEKRRRKSPGAGGGGANDGNQAATKSPRKAAAA
AARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQPPEPREEDDAAGG
VCLHVDKDKVSVEFCSACARKASSSLKM*
135 >lcl|NP_666313.1|Plus144978956..44980731 NT_039433 zinc finger protein 48 Zfp553 __SEG__ Chr7 {Mus musculus} MEASPGDEFEHSPQERDGPEIKEEEQLAPTLQVGNTSLKPDGIQCWDDLWDRREGLGKRQPRDPVPRILGEPRWGQGSNDRAAVCGECGKSFRQMSDLVKHQRTHTGEKP
YKCGVCGKGFGDSSARIKHQRTHTGEKAYRVRPPAPGPPKMPRSRIPAGERPTICGECGKSFRQSSDLVKHQRTHTGEKPYKCGICGKGFGDSSARIKHQRTHRGDQLPR
PVVPRRQPSPAAPAAPHRPKAQDKPYICTDCGKRFVLSCSLLSHQRSHLGPKPFGCDVCGKEFARGSDLVKHLRVHTGEKPYLCPECGKGFADSSARVKHLRTHSGQRPH
ACPECNRSFSLSSTLLRHRLTHVEPQDFSLAAYPVVPLIPSPPPPPLGTSPSLTPRSPSHSSDGPFGLPGLEPEPGGPQAGEPPPPLAGDKPHKCPECGKGFRRSSDLVK
HHRVHTGEKPYLCPECGKGFADSSARVKHLRTHQGERTRPPPPPSTLLRPHNPPGSVPIVPQSRVQGRPSGPSQLHVCGFCGKEFPRSSDLVKHRRTHTGEKPYKCAECG
KGFGDSSARIKHQRGHLALKPFGVGDGPPRPLKEESPAGLE*
136 >lcl|NP_666365.1|Plus1complement(14886911..14888182) NT_039206 zinc finger and BTB domain-containing protein 6 Zbtb6 __SEG__ Chr2 {Mus musculus} MAAESDVLHFQFEQQGDVVLQKMNLLRQQNLFCDVSIYINDTEFQGHKVILAACSTFMRDQFLLTQSKHVRITILQSAEVGWKLLLSCYTGALEVKRKELLKYLTAASYL
QMVHIVEKCTEALSKYLEIDLSMKNNQHTDLCQSSDTDVKNEEENSDKDCEIIEISEDSPVNLDFHVKEEESNALQSAAETLTSERMRMQSPELSAVDGGFKENEICILH
VESISTDDVENGQFSQPCTSSKAGIYFPETQHSLINSTVENRVTEVPGNTNQGLFSENSDGSHGTVNEIQNLDENFSLRHQCPRCPRGFLHVENYLRHLKMHKLFLCLQC
GKTFTQKKNLNRHIRGHMGIRPFQCTVCLKTFTAKSTLQDHLNIHSGDRPYKCHCCDMDFKHKSALKKHLTSVHGRSSGEKLSRPDLKRQNLL*
137 >lcl|NP_690034.1|Plus112458095..12459147 NT_039457 purine-rich element-binding protein gamma isoform a Purg __SEG__ Chr8 {Mus musculus} MERARRRGGGGSGGGRGRGGKNVGGPGLSKSRLYPQAQHSHYPHYSASATPNQSGGTSEIQELASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTL
SLSVAAELKDCLGDFIEHYAHLGLKGHRQEHGQSKEQVSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHSLG
QDQTIVLPAQGMIEFRDALVQLIEDYGEGDIEERRCGDDDPLELPEGTSFRVDNKRFYFDVGSNKYGIFLKVSEVRPPYRNTITVPFKAWTRFGENFIKYEEEMRKICNS
HKEKRMDGRRASGEEQECLD*
138 >lcl|NP_694736.2|Plus1complement(2928670..2930319) NT_039460 zinc finger protein 353 Zfp353 __SEG__ Chr8 {Mus musculus} MAENTGASKPRPCNTQPSPTESSQLVSGQSSEILTSKQTVMASASCSTQESTYTQNSTAYPAKAIGFHFGEPFENTSLNQQVVSAEQKISPAGFHHMQLNGTPKTFLPPQ
KTTRVDTRETFYNEDYWMRTLNSDKTLLVQNTAMCENQRVTFDNHQIALYGSHASQDPNVGHIFASEHDWTSYDSQMTTRNGGHLTLYGSQMTAPSYSQTLHPNQIITSF
SEQNYFEDQQSNLAVNNGFYEDQVILPNGYQAFYEPQMRANFDQTNDQMKSFSGQNVCKSQENLLSGECSLSGYQISGYRCDQDLIVNPQVPSPIGGQPLSDFQIQTSSF
DTTLPGSKRTRSSAEDNLACPLETSPRSEETFYLGQMRTSVDQNVYPSQNGTPNIKESLDRQVTSFSLQAPYVGEYSYPSRSPLIQKQPQKNSSASSLVQRQHPEMKLDF
KTQSPVSQKNPSPLKLYFCTYEGCTKFYNRAYHLKEHQKKHTCVRKYRCDEPGCTWSFFRLCDLNRHREKHSGERPYACPMCSTNYSRLVYLKKHLEKKHAHAQPTTAT*
139 >lcl|NP_694742.2|Plus1877608..879263 NT_039280 zinc finger protein 352 Zfp352 __SEG__ Chr4 {Mus musculus} MEMAENTGASQPGPCNTQPSPVESSQLFSGQSSEMLTWKQTVMESASCSTQETTCTQNSTAYPGKAIGFHFGQPFENTSWNQQVVSAEQKISPAGLYHTQLNSAPQICLP
PQKTTRVDTRETFYNEDYWMRTLNSDKTLLTQNTAMCENQRVTFDNHQIALYGSHAGQDPNVGHAFASEHDWTSYNSHMTTRNGGHLTLYESQMTAPSCSQTLHPNQIIT
SFSEQNYFEDQQSNLAVNNGFYGNQVILPNGYQAFYEPQMRANFDQTNDQMKSFSGQNVCKGQENLLSGECSLSGYQTSGYRCDQDLIVNPQVTSPIGGQPLSDFQTQTS
SFDTALPGSKRTRPSAEDNLACPLETSPTSEETLYLGQMRTSVDQNFYSSQNGTPNIKESLDPQVTSFSLQAPYVGESSYPSCSPLIQKQPQKNSSASSLVQRQHPEMKL
DFKTQSPVSQKDPSPLKLYFCTYKGCTKFYKRAYHLKEHQKKHTDKRKYGCDEPGCTWSFFRLCDLNRHKEKHNGERFYACPLCSTNYSRLLYLKKHLEKKHAQAQPTTA
T*
140 >lcl|NP_694749.1|Plus1complement(7123629..7124324) NT_039713 TGFB-induced factor homeobox 2-like, X-linked 1 Tgif2lx1 __SEG__ ChrX {Mus musculus} MEEAEGSPEETQDFMKYYSSFGIRLERTCKMKFHDSRELPRGNMLPLKSVKILRDWLCEHQFNAYPTVADKRMLSKNTDLSYLQVSNWFVNIRKHLRWEIRYKPYSLSHE
GQAANAAQKQHSNPSEEVKTQFNENADMQDLPLPIRQDSEEKVPYLESSPNQKVIAEDNIEKEEKISITEPWSSPEVAWPEEKPDFSSFYMLVDVAVQKAKEMEEQKKQN
PNPQGPQQQFM*
141 >lcl|NP_739565.2|Plus11870383..1873499 NT_039413 zinc finger protein 628 Zfp628 __SEG__ Chr7 {Mus musculus} MAGSHVDMAPASTTEGTGEKPGPTAPAPTPAAQYECGECGKSFRWSSRLLHHQRTHTGERPYKCPDCPKAFKGSSALLYHQRGHTGERPYQCPDCPKAFKRSSLLQIHRS
VHTGLRAFTCGQCGLAFKWSSHYQYHLRQHTGERPYPCPDCPKAFKNSSSLRRHRHVHTGERPYTCGICGKSFTQSTNLRQHQRVHTGERPFRCPLCPKTFTHSSNLLLH
HRTHGPAPGPAPAPAPPGETSRADTKVLVSDAYLQPRSPPEPPAPPPQPPPVVPELFLAAAETTVELVYRCDGCEQGFSSEELLLEHQPCPGPPVATQSQDVPAELPQAD
SALPQPPPATPGPPNFACLPCGKSFRTVAGLSRHQHSHGAASGQAFRCGSCDGAFPQLASLLAHQQCHVEEAAAGRPPPQAEVAEVTCPQEPVAPATPAPPPPPPPAPVV
SAERPYKCAECGKAFKGSSGLRYHLRDHTGERPYQCGECGKAFKRSSLLAIHQRVHTGLRAFTCGQCGLTFKWSSHYQYHLRLHSGERPYACTECGKAFRNTSCLRRHRH
VHTGERPHSCSVCGKSFAQTSNLRQHQRVHTGERPFRCPLCPKTFTHSSNLLLHQRTHSAERPFACPICGRGFVMAAYLQRHLRTHTPATTTSGTTGSAVASQPPAPLAA
APTPLAAQDVHVLPNLQATLSLEVAGGTAQPTPPGPAAPSSQTFLLVQTAQGLQLIPSSVQSPTPPPPPPPPKVILLPPASAGGPGSGAARPGPRSVGKAGQGTGVVWFP
GPGGLGLQGGANAGASGGGQSLIVLQNVGSGETGPQEVSGVQLQPAQEVATVQLQPAQEVTTVQLQPAQEVTTVQLQPLTGQVSNSNGGAGTTEAPNLLLVQSGATEELL
TGPGPGEVGDSEAGAGVVQDVLFETLQTDEGLQSVLVLSGADGEQTRLCVQEVETLSPGLAEPAATGPSGQKLLIIRSAPATDLLENSSVAGGTTTLQLLAPSAPGPVSA
PVGVPVAPPSQMVQVVPAVAGPGVMAPQNLPSIQIVQTLPAVQLVHTF*
142 >lcl|NP_742147.1|Plus1complement(890727..891866) NT_039299 transcription termination factor, mitochondrial precursor Mterf __SEG__ Chr5 {Mus musculus} MASRNIWCVRRNFLFDLRDWMLQYSAEVFLKSISFRPFSAECDSKDKESLEEEREDLLSNLVTMGVDIDMARRRQPGVFNKAVTNEQELKLFLLSKGASDKVIGSIISRY
PRAITRTPESLSKRWDLWRKIMASDLEIVNILERSPESFFRSNNNLNLENNIKFLCSVGLTHKCLCRLLTNAPRTFSNSLNLNKQMVEFLQETGMSLGHNDPRDFVRKII
SKNPSILIQSTKRVKTNIEFLQSTFNLNKRDLLLLICGPGARILDLSNDCTKKNYTNIRERLLSLGCSEEEVQRFVLSYLNMVFLSEKKFNDKIDCLIEEKISASQIIEN
PRILDSSINTLKTRIRELSHAGYDLSTSSIALLSWSQRRYEAKLKRLCG*
143 >lcl|NP_766174.1|Plus1complement(12274866..12276098) NT_039578 zinc finger protein 322A Zfp322a __SEG__ Chr13 {Mus musculus} MENHLGENHRRCTLQKRNVTRELKKGKHTMYALKRVKKIYIRVHEITQIDNQTYQCLEREQNFCENLARMCERTYTEEKPYRCDMCEKTFIQSSDLISHQRIHNYEKPYK
CSKCEKSFWHHLALSGHQRTHAGKKFYTCDICGKNFGQSSDLLVHQRSHTGEKPYLCNECDKCFSRSTNLIRHRRTHTGEKPFKCLECEKAFSGKSDLISHQRTHTGERP
YKCNKCEKSYRHRSAFIVHKRVHTGEKPYKCGACEKCFGQKSDLIVHQRVHTGEKPYKCLECMRSFTRSANLIRHQATHTHTFKCLEYEKSFNCSSDFIVHQRIHMEEKP
HQWSMCESDFLLGMDFVAQQKMRAQTEELHYKYSVCDKTFHHSSALLQHQTVHIDDEYICNMSEKGLDLSSHASETSRVS*
144 >lcl|NP_766328.2|Plus127659376..27661112 NT_039413 zinc finger protein 420 Zfp420 __SEG__ Chr7 {Mus musculus} MVTHDTMSVFCPGTRLPQHPRGYSTEKPYKCEECGKAFRRASHLSQHQSIHTGEKPYECKQCGKAFSRDSQLSLHQRLHTGEKPYTCKECGKAFTQSSQLILHHRIHTGE
KPYKCEACGKAFIRSSQLSRHQKVHTGEKPFECKECGKAFTQNSQLTLHQRLHTGEKLYDCKECRKVFTQLSQLILHRRIHTGEKPYECNECGKAFICGSQLSQHRKIHN
GEKPYECKECGKAFIRGSLLMQHQRIHTGEKPYKCDECGKAFIRGSQLTQHQRVHTNEKPYECKECGKTFSHGSQLTQHQRIHTGEKPYQCKECGKAFNRGSLLTRHQRI
HTGEKPYKCKECGKNFSRGSELTQHERIHTGEKPYECKECGKSFIRGSQLTQHQRIHTGEKPYECKECRMAFTQSSHLSQHQRLHTGEKPYVCSECGKAFARGLLLIQHQ
RIHTGEKPYQCRECGKAFIRSSQLTQHQRTHTGEKPYECRECGKAFGHGSQLTLHQRVHTGEKPYECKECRKAFTQSSHLSRHQRVHTGEKPYQCKECEKAFTRESQLMR
HQRIHIRGKSLDCKECRIDFNHHSQIFI*
145 >lcl|NP_780541.2|Plus1complement(9030561..9031670) NT_165773 hypothetical protein LOC103551 E130012A19Rik __SEG__ Chr11 {Mus musculus} METLCPPPRLAVPASPRGSPCSPTPLKPRRGTPEFSPLCLRALAFCALAKPRPSSLGLGPGELAPRTPVLLGPPASPCTGGWAADGLKHLGGQAGRPSDVSSPAREDADV
AVCPGGGEEEEGGGGFPHFGAGSCAPPGRCPAPLRPQDSPTNPAWSPPRPARGLDAASSPPLEPGSPPPSPPAGLSPEPAPSEQPVPASEAPGGGDPAPTAPEAPALSPS
TADAAPDPPRDLRQEHFNRLIRRSKLWCYAKGFALDTPSLRRGPERPAAKARGAAKKRRRPAPPPPSVQPRRPVPTLPTSSTFSLLDCFPCPPALVVEENGDLGPASSLR
LQGDAKPPPAHPLWKWQMGGPAVPEPPGLKSWWVNLEEL*
146 >lcl|NP_780645.1|Plus123009337..23011364 NT_039413 zinc finger protein 526 Zfp526 __SEG__ Chr7 {Mus musculus} MAEMVAEAAEIPTQSSGAVEISTAVSGELAEMATAVTEMTSGEALASSLFFQHHQFMCSECGSLYNTLEEVLSHQEQHLLTMSEEETLTTQDAGLEPELVPSTGEGPFQC
GECSQLILSPSELLAHQDAHLQESASQIQYQCGDCQELFPSPELWVAHRKTQHLSSAADEPPSPLPPPTPPPPPPPPPPPPPPEVKMEPYECPECSTLCATPEEFLEHQG
THFDSLEKEEHNGLEEEEEDEEEGEEEEDDDDEETDEEEASSELTADDTGSNKSTADSAQSCGDCPQHCTSSGARHKHRRASHGPASATHAFHCSQCQRSFSSANRLVAH
GRAHVGGTHECTTCSKVFKKAASLEQHQRLHRGEARYLCVDCGRGFGTELTLVAHRRAHTANPLHRCRCGKTFSNMTKFLYHRRTHTGKSGTPTRVATVSPAPAEPTPPP
LPPPAQLPCPQCPKSFASASRLSRHRRAVHGPPERRHRCGVCGKGFKKLVHVRNHLRTHTGERPFQCHSCGKTFASLANLSRHQLTHTGVRPYQCLDCGKRFTQSSNLQQ
HRRLHLRPVAFARAPRLPITGLYNKSPYYCGTCGRWFRAMAGLRLHQRVHARARSLTLQPPRSPSPVPPPPPEPQQTIMCTELGETIAIIETSQPLALEDTLQLCQAALG
ASEASGLLQLDTAFV*
147 >lcl|NP_780675.1|Plus1complement(55062507..55064624) NT_039207 zinc finger protein 770 Zfp770 __SEG__ Chr2 {Mus musculus} MPLRNVMAENNFKMLKIQQCVANKLPRNRPYICNICFKHFETPSKLARHYLIHTGQKPFECDVCHKNFRQLVHLERHQLTHNLPFSCNICQRHFKNLKTFVKHQQLHNES
YHNDVKVRRLLETKQEKPVYGMCNTFTADERWALHPCSKSDATYSTTKRRKNIHACTICGKMFPSQSKLDRHSLIHTGQRPFKCVLCSKSFRQSTHLKIHQLTHSEERPF
QCCFCQKGFKIQSKLLKHKQIHTRNKTLQNLPLKVKSPESCPLPNKLNAKQDAFESGDMGESEENNPLDVHSIYIVPFQCSECEECFESEQILNGHKCLPARGGRVPSRL
KRSCNYKTIVKKLLAKLKRAGGKKSDDLQSEKKRTFKSNYLKNCERSSGKPNIEQTQRTFVGSLSRHGSYKTVSKKKKKTLALPFSWQKQFQSQNTGKSLQGILTTGSIL
SMDGSVNNKDLSIYGSSGEEYLNCDMLQCGFSDSSENIHTGHKMCPCDKCDKVFPSISKLQRHYLIHTGQRPFDCNVCGKSFRQSAHLKRHKLTHIEKIPYSSFWRVDFG
NVNQLFIHPSDDVSYNASQQCEGLGSQSCESSESSQVSEIEVKVEPEDFLLGSHCRSRQSYLANALVESEQSHHCYSYLGRPERSDGLLYQCSVCCKHFRSPSKLERHYL
IHAGQKPFECSVCGKTFRQAPHWKRHQLTHFKERPQEKVVLDSTV*
148 >lcl|NP_780686.1|Plus122864574..22867276 NT_039413 zinc finger protein 574 Zfp574 __SEG__ Chr7 {Mus musculus} MTEESEETVLYIEHRYVCSECNQLYGSLEEVLVHQNSHVPQQHFELVGVADPGVTVATEAASGTGLYQTLIQESQYQCLECGQLLLSPSQLLEHQELHLKMMAPQEAVPA
KPPPKVPPLGSSAIHYECVDCKALFASQEMWLSHRQTHLRATPNKAPAPVVLGSPVVLGPPVGQARVAVEHSYRKAEEGGEGAAVPSVAATTEMVTEVELLLYKCSECSQ
LFQMPADFLEHQATHFPAPVPEAAEPATQQETQVPSPTEAAVSQPEPLPASDHSYELRNELRNGEAIGRDRRGRKPRRNNSGESGGAATQELFCSACDQLFLSPHQLQQH
LRSHREGVFKCPLCSRVFPSPSSLDQHLGDHSSESHFLCVDCGLAFGTEALLLAHRRAHTPNPLHSCPCGKTFVNLTKFLYHRRTHGAGGVPLPTTPVPPEEPAISFPEP
APAETGELEAPELPVCEESSAEPAAPGSYRCLLCSREFGKALQLTRHQRFVHRLERRHKCSICGKMFKKKSHVRNHLRTHTGERPFPCPDCSKPFNSPANLARHRLTHTG
ERPYRCGDCGKAFTQSSTLRQHRLVHAQHFPYRCQECGVRFHRPYRLLMHRYHHTGEYPYKCRECPRSFLLRRLLEVHQLVIHAGRQPYRCSSCGAAFPSSLRLREHRCA
AAAAQAPRRFECGTCGKKVGSAARLQAHEAAHAAAGPGEVLAKEPPAPRASRATRTPVAPSPTALSGTTSAAPAAPARRRGPECSECKKLFSTETSLQVHRRIHTGERPY
PCPDCGKAFRQSTHLKDHRRLHTGERPFACEVCGKAFAISMRLAEHRRIHTGERPYSCPDCGKSYRSFSNLWKHRKTHQQQHQAAVRQQLAEAEAAVGLAVMETAVEALP
LVEAIEIYPLAEADGVQISG*
149 >lcl|NP_780746.2|Plus1complement(16257685..16261278) NT_039476 zinc finger and BTB domain containing 38 Zbtb38 __SEG__ Chr9 {Mus musculus} MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNVLAASSLYFKNIFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETVTDLAAA
GKKLGISFLEDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPRITNAFSIIETENSNNMFSPLDLRASFKKVSDSMRTASLCQERASVCHEVEPVRTLAE
HSYAVSSITEAYRSQPPREQDSSSSAKTGKETGDALATKAKPCRKPKPQTQDSDSTTENMPLSLVTCPEVNQERSPQPAPDLSHSEPPSNEGDIHFPREDENQPSDAPGP
GAAEVPPLVYNCSCCSKSFDSSTLLSAHMQLHKPTQEPFVCKYCNKQFTTLNRLDRHEQICMRSSHVPIPGGNPPFLENYPTIGQDGTSFRSPESLGPENRIGELSSAGS
ALSDADHMVKFVNGQMLYSCIVCKRSYVTLSSLRRHANVHSWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCIFCLETFMTYYILKNHQKSFHAIDHRLSINKKTA
NGGLKPTVYPYKLYRLLPMRCKRAPYKSYRNSSYVSAQGSSQRGESAPDTFIVPNLQSSEMPTLDFQDGRNTLPSSPAVPVETPSRQGAPTSARVKNAEGIKWRKQAVKT
NLVDNFDSTEVSVSSTGNTVSATLQTEPACVSSVGKGSEHSASVISYSGSVPSVIVHSSQFSSVIKHSNTIASLTNSNHKSPSQPVVSPSLIKDSKPETDKASKPASRPK
SIKEKKKTAPSNRGEITEEAKYIADHGGSSGKTTNAEETSKIETYIAKPALPGTSTNSNVAPLCQITVKIGNEAIVKRHILGSKLFYKRGRKPKYQMQEETLPRENDPET
PGDSPLGLCQAECVEMSEAFDEVSDQDSTDKPWRPYYNYKPKKKSKQLRKMRKVKWRKERRSRSPVGRCRYPAELDRAEVKLPPDKAFEEEEEEEENKEMPKLQCELCDG
CPDGAAGAGAEGKPHQHLTSKPYICELCAKQFQSSSTLKMHMRCHTGEKPYQCKTCGRCFSVQGNLQKHERIHLGVKEFICQYCNKAFTLNETLKIHERIHTGEKRYHCQ
FCFQGFLYLSTKRNHERRHIREHDGKGFACFQCPKICKTAAALRMHQKKHLYKTLPKQEETGDTCHENADLLESQLCTDSEDSEQKDDIKAFAENVL*
150 >lcl|NP_786964.1|Plus1complement(34802141..34803166) NT_039674 transcription initiation factor TFIID subunit 7 isoform 1 Taf7 __SEG__ Chr18 {Mus musculus} MSKNKDDAPHELESQFILRLPPEYAATVRRAVQSGHVNLKDKLSIELHPDGRHGIVRVDRVPLAAKLVDLPCVTESLKTIDKKTFYKTADISQMLVATVDGDLYPPVEEA
AATADPKANKKKDKDKEKKFVWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKETENQGLDISSPGMSGHRQGHDSLEHDELR
EIFNDLSSSSEDEEDVNILDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSS
LQEELESLLEK*
151 >lcl|NP_795975.1|Plus1complement(45980087..45981100) NT_039433 hypothetical protein LOC319792 9130023H24Rik __SEG__ Chr7 {Mus musculus} MELAAPEVTRENLDGAKLLENRTSKFPGAPRSPLDRETALHERPLLARPEQPAPVEKMLDQQYLCRSGSGPKEETFVKTSDPAVPKAFKCRDCGLAVPSLSDLIHHQSSH
GCDRPYSCPECDKSFRRGSDLVKHYRVHSGEKPYPCPECGRCFSLSSNLTKHRRSHSGLRPHKCMECGEAFGRSADLAKHQRVHTGEKPYACAECGKTFRVSSNLIQHQR
THTGEKPYRCGLCGKSFSLSSNLLQHQRCHTGEKPYFCAWCGDSFGRSSYLLEHQRSHTGEKPYNCCECGKNFTNSSNCLRHQRTHNGEPPFRCLECGRGFSEITMFTEH
QRIHLSK*
152 >lcl|NP_796056.2|Plus131039992..31041452 NT_166318 transcription factor Sp8 Sp8 __SEG__ Chr12 {Mus musculus} MLAATCNKIGSPSPSPSSLSDSSSSFGKGFHPWKRSSSSSSGSCNVVGSSLSSFGVSGASRNGGSSSAAAAAAAAAAAAAALVSDSFSCGGSPGSSAFSLTSSSAAAAAA
AAAAAASSSPFANDYSVFQAPGVSGGSGGGGGGGGGGSGAHSQDSSHQPVFISKVHTSVDGLQGIYPRVGMAHPYESWFKPSHPGLGAAADVGSAGASSWWDVGAGWIDV
QNPNGAAALPGSLHPAAGGLQTSLHSPLGGYNSDYSGLSHSAFSSGASSHLLSPAGQHLMDGFKPVLPGSYPDSAPSPLAGAGSSMLSAGPAAQLGGSPRSSARRYSGRA
TCDCPNCQEAERLGPAGASLRRKGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLSKHVKTHSG
GGGSAGSGGGKKGSDTDSEHSAAGSPPCHSPELLQPPEPGHRNGLE*
153 >lcl|NP_796156.3|Plus141990929..41991624 NT_096135 class A basic helix-loop-helix protein 9 Bhlha9 __SEG__ Chr11 {Mus musculus} MLRGTPGLGLGGLNRAEDFVEDLGRSCSEAGRNFGVLRRSSLDEAEEAAGRKRERPTRSKARRMAANVRERKRILDYNEAFNALRRALQHDLGGKRLSKIATLRRAIHRI
TALSLVLRASPAPRWPCGHLECHGQAAQGSSTGNSSFSVPRSAPSPIAPSLTRRDIASPLVPPTPRCASCSPHSHLGRPRVMAEVPNLAQTSGGNWRQCPGAPPVRPVSW
RWGSGLGYQHS*
154 >lcl|NP_803426.2|Plus117832421..17834025 NT_039500 zinc finger protein 280b Zfp280b __SEG__ Chr10 {Mus musculus} MEQPFTVDDEDEQDPEPQPRSGEPIQVLDDDAAEDAELIFVGVEKVKEDAELIFVGVTSASQPANSNILNRVTPGSRLKRKHDRLRATTTQRLQPSRPAAPTSEAVVVLP
ASPAESRSTDSPIAIEPLSESDYRSSSPQVVPSSSSKCCSPLVTLSSSENSPVKAALSGGDLNENLYVSKCHFSINPQRPDHSIEIVEPLSSALPPSGTFHTSNMQQRTP
SFDAPNSLSRLVNGAPPSEDSAHPRQDSGLAEADFSSPASQETFDPKKGSLTLLLSDFYYGQYKGDGKPEQKTHTTFKCPSCLKALKNVKFMNHTKHHLELERQGSEDAW
ESHTTCLRCHRQFDSPFQLECHIDRVHTSPDPSVVCKICELSFETDQVLLQHMKDNHKPGEMPYVCQVCKYRSSGFADVETHFTKCHVNTKNLLCPFCLKIFKTGMPYMC
HYRGHWERSGHQCSKCRLQFLTFKEKMEHKTQCHQMFKKPKQLEGLPPETKVVIQVSLQPVESESVKVASITVSTTDWEPSNPRPQGRLSQKPH*
155 >lcl|NP_808233.1|Plus1102150..103643 NT_110626 zinc finger protein 3 Zfp3 __SEG__ Chr11 {Mus musculus} MGTEKKEGLPKEETSEDSKPHGQTVEKLAQEVCHGHEFGEASEEDMSEGHLRESSKEIIEKRYPQERHFASGLLIFKKSSSGEKTSENPRGFNPNPSVLCHGGAERASAC
AASGHNCLGSIELTKAQGPPVGEKPHTCKECGKAFNQNSHLIQHMRVHSGEKPFECKECGKTFGTNSSLRRHQRIHAGEKPFACTECGKAFIQSSHLIHHHRIHTGERPY
KCEECGKAFSQNSALILHQRIHTGEKPYECNECGKTFRVSSQLIQHQRIHTEERYHECSECGKAFKHSSGLIRHQKIHTGEKPYLCNECGKGFGQSSELIRHQRIHTGDK
PYECSECGKTFGQNSEIIRHIRIHTGEKPYVCKECGKAFRGNSELLRHERIHTGEKPYECFECGKAFRRTSHLIVHQRIHTGEKPHQCNECARTFWDNSELLLHQKIHIG
EKPYECSECEKTFSQHSQLTIHQRIHTGEKPYECQECQKTFSRSSHLLRHQSVHCSE*
156 >lcl|NP_808233.1|Plus1102150..103643 NT_110626 zinc finger protein 3 Zfp3 __SEG__ Chr11 {Mus musculus} MGTEKKEGLPKEETSEDSKPHGQTVEKLAQEVCHGHEFGEASEEDMSEGHLRESSKEIIEKRYPQERHFASGLLIFKKSSSGEKTSENPRGFNPNPSVLCHGGAERASAC
AASGHNCLGSIELTKAQGPPVGEKPHTCKECGKAFNQNSHLIQHMRVHSGEKPFECKECGKTFGTNSSLRRHQRIHAGEKPFACTECGKAFIQSSHLIHHHRIHTGERPY
KCEECGKAFSQNSALILHQRIHTGEKPYECNECGKTFRVSSQLIQHQRIHTEERYHECSECGKAFKHSSGLIRHQKIHTGEKPYLCNECGKGFGQSSELIRHQRIHTGDK
PYECSECGKTFGQNSEIIRHIRIHTGEKPYVCKECGKAFRGNSELLRHERIHTGEKPYECFECGKAFRRTSHLIVHQRIHTGEKPHQCNECARTFWDNSELLLHQKIHIG
EKPYECSECEKTFSQHSQLTIHQRIHTGEKPYECQECQKTFSRSSHLLRHQSVHCSE*
157 >lcl|NP_808311.1|Plus151178185..51180866 NT_078297 zinc finger protein 281 Zfp281 __SEG__ Chr1 {Mus musculus} MKIGSGFLSGGGGPSSSGGSGSGGSSGSASGGSGGGRRAEMEPTFPQSMVMFNHRLPPVTSFTRPAGTAAPPPQCVLSSSTSAAPAAEPPPPPAPDMTFKKEPAASAAAF
PSQRTSWGFLQSLVSIKQEKPADPEEQPSHHHHHHHHYGGLFAGAEERSPGLGGGEGGSHGVIQDLSLLHQHAQQQPAQHHRDVLLSSGSRTDEHGNQEPKQDANVKKAK
RPKPESQGIKAKRKPSASSKPLVGEGEGAVLSPSQKPHICDHCSAAFRSSYHLRRHVLIHTGERPFQCSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHME
RHKRTHSGEKPYKCDTCQQYFSRTDRLLKHRRTCGEAIAKGAASAEPGSSNHNSMGNLAVLSQGNTSSSRRKSKSKSIAIENKEHKTGKTNESQMSNNINMQSYSVEMPT
VSTSGSIIGTGIDELQKRVPKLIFKKGSRKNADKSYLNFVSPLPDVVGQKSLSGKPGGSLGIVSNNSVETISLLQSTSGKQGPISSNYDDAMQFSKKRRYLPTASSNSAF
SINVGHMVSQQSVIQSAGVSVLDNEAPLSLIDSSALNAEIKSCHDKSGIPDEVLQSILDQYSGKSETQKEDPFNLTEPRVDLHTSGEHSELVQEENLSPGTQTPSNDKTS
MLQEYSKYLQQAFEKSTNAGFTLGHGFQFVSLSSPLHNHTLFPEKQIYTTSPLECGFGQSVTSVLPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLIDSQK
NLETSSAFQSSSQKLTSQKEQQKNLESSTSFQIPSQELASQIDPQKDIEPRTTYQIENFAQAFGSQFKSGSRVPMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPC
STRVKTPTSQSYR*
158 >lcl|NP_808373.1|Plus1complement(912158..913570) NT_039716 Myb-like DNA-binding domain containing protein 4932411N23Rik __SEG__ ChrX {Mus musculus} MSSVLLSEDSDRNLMLCLQNEANEMENPTEPLNKRPCLSSEVDSTSYMSALEFPLQEMEQSFGLVTTTATEVAEEEFGGENMMQFEVLKDDKQYEVFPLPNKEESVVSQA
WFTSKEAKDALTHQGQKWKQGMWSKEETAILMNNIERYMKDHGVENPAEIIFKMAKGKRKDFYRSVSLGLNRPLFSVYRRVVRMYDDRNHVGKYSPEEIEKLKELWQKHG
NDWITIGAAMGRSPSSVKDRCRLMKDTCNTGKWTEEEEQLLGDVVHELTCTEVDEKVTHGVCWATVAQRVGTRSAKQCRAKWLNYLNWKQTGGIEWTRKDEVTLIQRLVE
LDVSDESEIRWDELAKGWESVRSPQWLRNKWWIIKRQITNHKDFAFPVLVRCLQQEYESQNASLRFWENKSGSEVPDSNPDIIFQQVPFGVTSIENNNASICTDPMTGLQ
ISFQLIPRPTTELPDAVVDSETITLPTGPQ*
159 >lcl|NP_808421.1|Plus1complement(91069071..91069901) NT_039606 transcription factor SOX-21 Sox21 __SEG__ Chr14 {Mus musculus} MSKPVDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGSVADAEHPA
LKAGAGLHAGAGGGLVPESLLANPEKAAAAAAAAAARVFFPQSAAAAAAAAAAAAAGSPYSLLDLGSKMAEISSSSSGLPYASSLGYPTAGAGAFHGAAAAAAAAAAAAG
GHTHSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQLDPYPAAYAAAL*
160 >lcl|NP_848830.1|Plus1complement(31971479..31972540) NT_039551 cell cycle control protein 50B Tmem30b __SEG__ Chr12 {Mus musculus} MTWSATARGAHQPDNTAFTQQRLPAWQPLLSAGIALPLFFCAGLAFIGLGLGLFYSSNGIKELEYDYTGNPGTGDCSVCAAKGQGRAPPPGCACSWSFTLPELFPGPVYL
YYELSNFYQNNRRYGVSRDDAQLSGLASALRHPANECAPYQFRSDGLPIAPCGAIANSLFNDSFSLWHQRQPSDPFVEVPLDRTAIAWWTDYHVKFRNPPLVNGSLALAF
RGTAPPPNWHRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGTYRVNITYNYPVRAFGGHKLIILSNISWMGGKNPFLGIAYLVVGSLCIV
MGFVMLVVYIRYQDQDDDDNDDE*
161 >lcl|NP_848876.2|Plus1complement(23634467..23635873) NT_096135 zinc finger protein 672 Zfp672 __SEG__ Chr11 {Mus musculus} MFTAPGMATTQERPYSCSVCGKSFQYSAVLLRHERAHGGDKRFCCLECGERCARAADLRAHRWTHAGQTLYICSECGQSFSHSGLLDLHLGTHRRRSRTRPCRLCGRRFP
HVPALLLHRARQHPPEKPHRCPLCARSFRQSALPFHLARAHPPEIITVTAPSPSTLYHCTQCPRAFHSSAGLRNHSRIHVVPSLSDPGTEAHLCGICGKSFSKSSTLTRH
LQRHSGEKPFKCPECGKGFLESATLVRHQRTHTGEKPYACSDCGRCFSESSTLLRHQRSHQGERPHVCATCGKGFGQRYDLVVHQRSHTGERPFPCPQCGRGFTDRSDLT
KHLRTHTGEKPYHCELCGKRFTCISNLNVHLRNHAGHKPHKCPECGKSFSVASKLALHRKTHLGERTAECTECGKFFSHGRSLSQHQRSHRRARAAAMAATTTTTVVTEV
TIGPSLTLTGPTEQEKSGLLVSPFQETC*
162 >lcl|NP_848892.1|Plus151198930..51199337 NT_039240 helix-loop-helix protein 2 Nhlh2 __SEG__ Chr3 {Mus musculus} MMLSPDQAADSDHPSSTHSDPESLGGADTKVLGSVSDLEPVEEADGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPD
KKLSKIEILRLAICYISYLNHVLDV*
163 >lcl|NP_849222.3|Plus1complement(59435106..59436242) NT_039240 protein arginine N-methyltransferase 6 Prmt6 __SEG__ Chr3 {Mus musculus} MSLSKKRKLESGDSGGAGAGGEGAEEENGGEQEAAPPRPRRTKSERDQLYYECYSDVSVHEEMIADQVRTEAYRLGILKNWAALRGKTVLDVGAGTGILSIFCAQAGARR
VYAVEASAIWQQAREVVRLNGLEDRVHVLPGPVETVELPERVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFVAPISDQMLEWRLGFWSQVKQHYGV
DMSCMESFATRCLMGHSEIVVQDLSGEDVLARPQRFAQLELARAGLEQELEAGVGGRFRCSCYGSAPLHGFAVWFQVTFPGGDSEKPLVLSTSPFHPATHWKQALLYLNE
PVPVEQDTDISGEITLLPSPDNPRRLRILLRYKVGDHEEKTKDFAMED*
164 >lcl|NP_898963.2|Plus1complement(19293986..19294837) NT_039264 zinc finger protein 691 Zfp691 __SEG__ Chr4 {Mus musculus} MGSEKEQRPEAHLPEEGEGAKPWRVDGSKDSQITPREDHGQESLLAGLHGTHPPKTRQKVTAQAGGPRDPMLFSSPETDEKLFICAQCGKTFNNTSNLRTHQRIHTGEKP
YKCSECGKSFSRSSNRIRHERIHLEEKHYQCAKCQESFRRRSDLTTHQQDHLGQRPYRCDICGKSFTQSSTLAVHHRTHLEPAPYICCECGKSFSNSSSFGVHHRTHTGE
RPYECTECGRTFSDISNFGAHQRTHRGEKPYRCTLCGKHFSRSSNLIRHQKTHLGEQDEKDFS*
165 >lcl|NP_899119.1|Plus1complement(23667885..23668145) NT_039625 keratin associated protein 16-10 Krtap16-10 __SEG__ Chr16 {Mus musculus} MSYYSGYSGGLGYGYGGFGGLGCGCNSIRRLGCGCGSGSYGYGSGFGGFGYGSGFGGYGYGSGYGGYGYGCGRPSCCGGYGFSSFY*
166 >lcl|NP_899121.1|Plus14196141..4197256 NT_109315 forkhead box protein E1 Foxe1 __SEG__ Chr4 {Mus musculus} MTAESAPPPPPQPETLAAVKEERGEAAAAGAGVPAEAAGRGAGGRRRKRPLQRGKPPYSYIALIAMAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLN
DCFLKIPREAGRPGKGNYWALDPNAEDMFESGSFLRRRKRFKRSDLSTYPAYMHDAAAAAAAAAAAIFPGAVPAARPAYPGAVYAGYAPPLAAPPPVYYPAASPGPCRVF
GLVPERPLSPDLGPAPSAAGGSCAFAAAAGAAGTGSFQPAVCTGARPVNPAAYAAAYAGPDGAYPQGASSALFAAAAGRLAGPASPPAGGGSGGVEATVDFYGRTSPGQF
GAALGPCYNPGGQLGAGGGGAYHSRHATAYPGAVDRFVSAM*
167 >lcl|NP_899141.1|Plus1complement(46848509..46850308) NT_039706 retrotransposon gag domain-containing protein 4 Rgag4 __SEG__ ChrX {Mus musculus} MSEAAGNLNSLRLANVALREELNALRGENVQLGLQLGRALAEVNSLRGNVSSYIRWPMPIVPVLAEENFEFLLNETDPTPEEEEEEEEEVPFLCWPPPRTDPEYVSDDLL
INVVQDYTNPDGSSDPPLSPSPSQPELHSPMLKEPTFEFLLPPLERPDIEPFSGDPVYLAEFLMQLETFIADHEDHFPGGAERVAFLISFFTGEARDWAISVTQEGSSLH
ANFPRFLDEIRKEFCGPIPSRVAKKAIRKLKQGNCTLGSYADAFQFLAQFLSWDDCRLQNQFLKGLSEIFRKELLWSTEVADLDELILECVKIERKVRVPKTASLTGVQN
SCCPFALIPNEDENEGVEFYSENEGEGEEAGGYRLYLKDQRQHMTAFPQEMREEEEEMRKEEDEMEDEEDEDEDEDYEFEEEDEDDDDEEEEEEEEEEEDKEEEMKNEDS
DENKYEEEDEVIVRVLEPEQEQEREEIEHEHVYVHEHIHAHVHTLAAHHHGLHGELMVMDEPVLVDTSTQTISSAIGYHAENYLGVSPSVMHSSRQRSQNRVPLLEGLPG
TNSSFYSPPPLMRHAGRLGQRQMRRCPSVLFCLTPRQGGHRATQGRIRV*
168 >lcl|NP_908998.1|Plus1complement(21781486..21786720) NT_166318 retrotransposon-like protein 1 Rtl1 __SEG__ Chr12 {Mus musculus} MIEPSEDSFETMMELKNPSSKQMESSEGSSNTVEETPGSSGAQAGAQAGAQAEAQAETQVEAQAEAQAEAQVEAQVEAQAGSDSGPAQEEKEPPSGPLKEMQELPTNLLQ
EVEEPSSGPHQEMQELPTDLLQEVEEPSSGPHQEMQELPTDLLREVEEPSSGPYQEMQELPTDLLREVEEPSSGPYQEMQELPTDLLREVEEPSSGPYQEMQELPTDLLR
EVEEPSSGPYQEMQELPTDLLREVEEPSSDPCEASSNDLPQDMEESSDDGSNQESSDGSNHELSNGSNHESSFGSNPESSDVSNLESSGGSNQESSDGSQKESSYDSNPE
LSDNSNQELSDNSNQESSDSSNQSSDISNQEGSEPLSEASDYSMDETINSSETQSDQDDTDLGDDEEEEEEEGGEEEGQPKNSPEEVVATMGNVISLFLRMQDLKEQQRV
AERLMMQAINEGRLPSLRPFSGDRRDYHEFVVLCQMTMQNYPSMLYNDELRVKFVIRHLTDLALEWANDLVEQNSPVINNFSAFLEAMSEKFEYRQTLRVAEDAMFNIRQ
GNRCAADYINEFRGLIPTLGWPDEVLQAHLCQGLNEEIRHYLFRIPQPNSLDNLIVLVLQLEEKLAERRALLRLPPESRPRSVAWMDAPAPEKWRVSSWLPNEFHPDIDR
DHLFLLLLVRVDPYHSVAVRALVDSGAEGNYMDERFAQEHYVELYEKPYPQIIQGVDGIPIGNEPVWLCTEPLVCVHQKHYEYIEFDILPSPNFSIVLGMKWLRTHAPEV
DWMRGRCTFHSPYCLRNCFTPPPPCIALETYSISLLPGLPHTYSDLADVFNPREADDETSDQPSSDGSDDLSESEPSELQQAGDSDQSGVFYESGARETLEPVSARMQEK
ARQQEKAREQEEYWILYDMLTDRQDYTQMVPELFDQLHGAAWFTKLELLGIKESEMRHTVTHTEDTWRASFGFGLHQMRCYRPFTMNSYSDEGNNIVHFILKDILGLFVI
CHGREVLVYSMSQEEHSQHVRQVLVRFRYHNIYCSLDKTQFHRQTAEILGFNISPKGVKLNKNLMNLIVGCPVPGSRRCLQSVIDLVYPYRHFVENFAVIAAPLVRQLLS
SEPYYWGEEEQEALESLKRAFRKSPVLYHPKPQNPFYLETDITGSFLSASLVQTDDETGKKSTCAFYSRPLSTMEVEYPRVEMRILPIRAAFMVWCRYLENTEEPIMILL
NTEDLASLNNDRLTVLLPGHWVFFFSHFNFGVMEMPAEGDTQALFRRCWNQRGFRARFLRPLLLMSIRANLRYFDRSSETEDKEDDEEEEEEDGEEEEGEEEEDGEEEEG
EEEEDGEEEEEEEEDDEEEEGEEEEDGEEEEGEEEEDGEEEEGEEEEDGEEEEGEEEGEEEEEGEEEEEEEEDEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEDEEEEDE
EEEDEEVPSMVRELLAAIPMDHILNGLLAHFSVAQIRAVVLNFFRGLLYWKSLLGVAAVLVMLRARQPLSPVPAPNLEVARPQHRHTLRLILDSTLIASSGMATAIAQLL
SQMPPLVGANTLPARELAELFLGPRCWHRNALHSQPPRGMRFTPGFWLTLCEFFGVRVNPEDDVFPDPYQHRYLELHVVGDEDVVLREALQDDLQRYRQCGLHDGLQDTS
QDAQDNDVQEDLFGDQEAVTFRPRNLLDPEVLDFLNNRLLYTLGTDGRLTLLSRDQVAQALTRFLAMASRMALPSPAREQARLEELSDSDDELD*
169 >lcl|NP_919331.1|Plus1complement(36863277..36864356) NT_039621 transcription factor MafA Mafa __SEG__ Chr15 {Mus musculus} MAAELAMGAELPSSPLAIEYVNDFDLMKFEVKKEPPEAERFCHRLPPGSLSSTPLSTPCSSVPSSPSFCAPSPGTGGGAGGGGSAAQAGGAPGPPSGGPGTVGGASGKAV
LEDLYWMSGYQHHLNPEALNLTPEDAVEALIGSGHHGAHHGAHHPAAAAAYEAFRGQSFAGGGGADDMGAGHHHGAHHTAHHHHSAHHHHHHHHHHGGSGHHGGGAGHGG
GGAGHHVRLEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDLYKEKYEKLAGRGGPG
GAGGAGFPREPSPAQAGPGAAKGAPDFFL*
170 >lcl|NP_950190.2|Plus1complement(14893935..14895257) NT_039206 zinc finger and BTB domain-containing protein 26 Zbtb26 __SEG__ Chr2 {Mus musculus} MSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDVEVQGHKIVFAAGSPFLRDQFLLNDSREVKISILQSSEVGRQLLLSCYSGVLEFPEMELVNYLTAASFL
QMSHIVERCTQALWKFIKPKQPMDSKEGSEPQSASPQSKEQQGDARGSPKQDLPCIHPSEDSMDMEDSDIQIVKVESIGDVSEDRSKKDENQYISSEPTALHSSEPQHSL
INSTVENRVNELDQSHLHNYALSYTGNDDIIMTSKDVFGPNIRGVDKGLQWHHQCPKCTRVFRHLENYANHLKMHKLFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKI
CGKTFSQKCSLQDHLNLHSGDKPHKCNYCDMVFAHKPVLRKHLKQLHGKNSFDNANERSVQDLTVDFDSFACTTVTDSNCQPQPDATQVLDAGKLTQAVLSLRSDSTCVN
*
171 >lcl|XP_001004349.2|Plus1complement(261774..263579) NT_039424 uncharacterized protein C2orf78 homolog isoform 2 Gm9271 __SEG__ Chr7 {Mus musculus} METSLGLPPSGQTHYQLHSPELCNTCVQVSQIRPPAVNGDRALTAPIYSPSQFLALPTTPSLEQPEDKTMPEIKEGTKENQDTPIVTLEHPDLQQPLHCTDTESLRQKPD
SDNAHLGCIFMVPKELVGLEKEIGSSFDFKDITRFGADIQLPHLLNTLTDIDQDQSCENWRVTSGPSDQVRKNKHKSFDLLEGDPQAKIQHQDLVEGEGAVAVTGASDRV
IDNMAKHPEGKAPKGPPSKNRRARKQRQERPSGSENTSKKTEELKQSRNRVKAEEKPSIPKTKRKRNPPELSQNSFKKPRTNLAMHMLESVQVFHPLGKKSEKKTGISSF
RGLRTFTSNKDPGPGSGSVTTTVLNMPCEGQVPPKSPGKVQRAESSVDKDCLSPSQYELPPAGKVKLVPLPFPTLDKPQSRPASRKPLSLALRRPTTVYPVQPHSHSAQP
TTLRPAQPPPVSSSLIASAKPAPPISSSASRPNVTNPNQSSAVNQLATSRPVPYREPSHTSFQGELVSAARNKVPSPPKPQTQYLLHDFSRQPIPWKKVDILGPVVSQPI
TKEQRPEREAMKRRAQQERENAVKNPSTGKLQIFLQRERDMEISQYYGYAM*
172 >lcl|XP_001472691.2|Plus14600220..4600933 NT_039596 CCR4-NOT transcription complex subunit 1-like Gm6158 __SEG__ Chr14 {Mus musculus} MRLPDPFTPNLKVDMLSEINIAPRILTNFTGVMPPQFKKDLDSYLKTRSPVTFLSDLRSNLQVSNEPGNRYNLQLINALVLYVGTQAIAHIHNKGSTPSMSTITHSAHMD
IFQNLAVDLDTEGRYLFLNAIANQLRYPNSHTHYFSCTMLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNHEFVHCAPEIEKLFQSVAQC
CMGQKQAQQVMEGTGAS*
173 >lcl|XP_001474306.2|Plus123720651..23720884 NT_039625 hypothetical protein LOC100040201 Gm10229 __SEG__ Chr16 {Mus musculus} MCGYYGNYYGGRGYGCCGYGGLGYGYGGLGCGYGSYYGCGYRGLGCGYGYGCGYGSGSLYGCGYGCGSGYGSGFGYY*
174 >lcl|XP_001474317.1|Plus123983785..23983955 NT_039625 hypothetical protein LOC100040374 Gm2740 __SEG__ Chr16 {Mus musculus} MCYYGSYCGGLGYGYGGLGCGYGCGYGCGYGCGYGGYGYGCFRPLCCGRYWSYGFY*
175 >lcl|XP_001474347.2|Plus1complement(23746500..23746736) NT_039625 hypothetical protein LOC100040214 Gm10228 __SEG__ Chr16 {Mus musculus} MCGYYGNYYGGRGYGCCGYGGLGYGYGGLGCGYGSYYGCGYRGLGCGYGYGCGYGSRSLYGCGYGCGSGYGSGFGYYY*
176 >lcl|XP_001474401.2|Plus123797456..23797671 NT_039625 hypothetical protein LOC100040249 Krtap6-3 __SEG__ Chr16 {Mus musculus} MCYYGSYYGGLGYGYGGLGYGYGCGYGCGCGYGCGCGCGCGYGCGYGDYGGYGYGCCQPLCCRRYWSCGFY*
177 >lcl|XP_001474429.2|Plus1complement(23811819..23811983) NT_039625 hypothetical protein LOC100040267 Gm2683 __SEG__ Chr16 {Mus musculus} MCYYGGYYGGLGYGYGGIGYGCGCGYGGYGCGYGYGYGCCRPLCCRRYWSYGFY*
178 >lcl|XP_001474867.1|Plus1complement(307944..308753) NT_111910 cyclic AMP-dependent transcription factor ATF-1-like Gm1862 __SEG__ ChrX {Mus musculus} MEDSHKSNTTESTSQPGSTVAGPHVSQIVHQVSSLSESEESQDSSDSIGSSQKAHGILARRPSYRKILKDLSSEDTRGRKGEGENPSISAITSMSVPAPIYQTSSGQYIA
IAPNGALQLASPSTDGVQALQTLTMTNSSSTQQGTILQYAQTSDGQQILVPINQVVVQTASGDMQTYQIRTTPSATLLPQTVVMTSPVTLTSQTTKTDDPQLRREIQLMK
NREAARECRRKKKEYVKCLKNRVAVLENQNKTLIEELKTLKDLYSHKSV*
179 >lcl|XP_001477745.2|Plus1complement(8045245..8045856) NT_039589 zinc finger protein 286A-like Gm3609 __SEG__ Chr13 {Mus musculus} MKEVRVQRKRLNILNVIKSFFYAHSHAQRHERIHTEMNPLGIIQFVEAFAQHRLQLHKRAQTRKKLYEWKQCGKAFEDHSHLKSYEGIHTGEKPYDCHQCEKAFSSHSNL
LQPKGTHTGEKCYECDLCGKAFSQHSRLKRHGRIHTGEKPYRCNNCEKAFSQQIHLQLHRRIHTGEKPYKYNKCEKAFLQHYNLQRHKRIHIG*
180 >lcl|XP_001480824.1|Plus1complement(67576392..67576595) NT_039207 DNA-directed RNA polymerases I, II, and III subunit RPABC5-like Gm10774 __SEG__ Chr2 {Mus musculus} MIIPVRCFTCGKIVGNKWEAYLGLLQAKYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK*
181 >lcl|XP_003084516.1|Plus1complement(24685540..24685716) NT_039185 DNA-directed RNA polymerases I, II, and III subunit RPABC4-like LOC100504598 __SEG__ Chr1 {Mus musculus} MDAQKDVQPPKQQPMIDICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR*
182 >lcl|XP_003084658.1|Plus1complement(1508456..1510318) NT_039268 zinc finger protein 761-like LOC100503584 __SEG__ Chr4 {Mus musculus} MSPLIAPPFFSENHCIRGKNGKVLDQDSQYIVHEHMNIQEKSSKWDKLSNVILESLQCTPYKTNHSSDALQFSTQKRLKPRNTKEVCKYNDSVNSLSLFSTISLNQGINM
QKKKHNRNAELDKIFVSKHKVMVKKDNIAGNPYKCSEFHKYLTQREKLQSQQRIYHGKKPYESSKSDKCFTHQIHLSIHQGIHTEEKIYKCSECDKCFKNKFNLTMHQRI
HKGEKPYKCSECGKCFTDKTSLRIHQRIHTGEKPYKCSECGKCFTEKSSLRIHQRIHTGEKPYKCSECGKCFTEKSSLRIHQRIHTGEKPYKCSECDKCFTQQSYLSIHQ
RIHTGEKPYKCSECDKCFTKQSNLSIHQRIHTGEKPYKCSECDKCFTQQSHLSIHQRIHTGEKPYKCSECDKCFTQQSYLSIHQRIHAGEKPYKCSECDKCFTTKGNLII
HQRIHTREKPYKCSECGKCFTEKSSLRIHQRIHTGEKPYKCSECDKCFTKQSKLSIHQRIHTGEKPYKCSECEKCFNEKNSLKIHQRIHTGERPYKCSECDKCFTQKSYL
NIHQRIHAGEKPYKCSECDKCFTTKGNLIIHQRIHTREKPYKCSECDKCFTQKSQLSIHQKIHTGEKPYK*
183 >lcl|XP_003084988.1|Plus1complement(4059457..4059933) NT_039590 transcription factor BTF3 homolog 4-like LOC100504125 __SEG__ Chr13 {Mus musculus} MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSL
TSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN*
184 >lcl|XP_003085203.1|Plus112563205..12563612 NT_039649 transcription elongation factor B polypeptide 1-like LOC100504036 __SEG__ Chr17 {Mus musculus} MQVNSRPNLHLARKLLKFLWAQIEFCKNITDGEEKTCGGCEDPDAVYVKSTSSGGHEFIVKREHALTSGTIKAMWGGPGQFAKDETKEVNFRRVPHMCMCFTYKVPILTA
PLSSTDILEFPTALELLIAANFLDC*
185 >lcl|XP_003085252.1|Plus1complement(54279364..54279540) NT_039674 DNA-directed RNA polymerases I, II, and III subunit RPABC4-like LOC100502981 __SEG__ Chr18 {Mus musculus} MDAQKDVQPPKQQPMIYICGECHTENEIKSRDSIRCRECGYRIMYKKRTKRLVVFYAR*
186 >lcl|XP_003085278.1|Plus134711989..34712696 NT_039687 predicted gene 6747 Gm6747 __SEG__ Chr19 {Mus musculus} MRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYA
NYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILTDHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSA
SDYEVAPPEYHRKAV*
187 >lcl|XP_003085290.1|Plus134768230..34772921 NT_039687 uncharacterized protein C10orf12 Gm340 __SEG__ Chr19 {Mus musculus} MVKLCNHHQKQFIRVLSDLYTESQPGSEALQPLDSTVMDVSACDSGCAQLSGRENEKDDCLEESSPASVKLFLDSSGSPSSLNVTEETMKEPPPETDSVDGRDSAASSSA
VQKGSSEPPDAQHNPTGSADSSTMGCLGTLDAFSSNSPHSAKSLEGQTTGQEQDTDMKPCEDAEDSAPAPVQSLAAVEEVAENTEEGGSCIVSQRNSFKALSEETWDSGF
MGNSSSTADKENALQSSSKSSFHQDLETDEQDARPKQENHLHSLGRNKVGFQTYPRDKGHFDHSRGGWLAPSPTPTVHRASNGHSQTKMMSASIKTARKSKRASGLRIND
YDNQCDVVYISQPITECHFENQRSILSSRKTARKSTRGYFFNGDCCELPTVRTLARNLCSQDKGSCSQVASEAVMTPKQTLTVPTSKHTVGVQLPTVGAQLPTTDVQPPT
AGTQLPTADVQSPTVGAQLPTADVQSPTVGAQLPTADVQPPTVDVQLPTADVQPPTGGVQLPTADVQPPTVGAQLPRVDVQLSSVGTQLPTADVQPPTVGAQLPAADVQL
PTVDVQISTVDTQLSTVGEQPLEDICDDPRKERTSLEGGDEDTSSAKKHQEAEVCLSLREQDPSSSPRPGETTTSSPACLLPTLLPNDNMSEVPEGSIVVSPPTESVLSF
QEQDQPPASQLGPEEMQAQECHLVPTAGSTPFTSREDSEDLLCRPQSSPKTSIREESSPCSEDEGSTVALDPPLGLELSEHDQSTSTEAETRDIPGETLLLDDSLPLLES
SIVTDENPSEMEEGEATSGTGHLEAHDNDTKYSAENDPSEPNSDSPEENVDKKKKARKFPEASDRCLRSQLGDPSSSDRYPGSQGLDSSAACSEIKVSKNPAVKHSKREG
DSGRVTSEGPVIDSIHPDNLEDPEDSGVSEHSSDEETKQETEGVGVITRQTVKNMLAKEIKREEGGTYPNSDPATVGQPLPGDNLETHVWSKIDERDAHVPSESIPCKRD
PEQVKENPGHLAIQDTEAAAMSEVDPEDTHHKDDAGLAPCSSSGISASHSDGADGPPKSVTRPKRLPSSTYNLRHAHCSNALDTAKMTSEKQGTQVNPAAKEGGASESAE
PLDEEDEDSVVEEQPKFIGWCAEEENQELIASFNAHYLRVQKGWIQLEKEAQPTARARSKSDKLKEIWKSKKRARKCRGSLEVQKFSPVQMLFMTNFKLSNICKWFLETT
ETRSLVIVKKLNTRLPGDIPLVKHPLQKFPPSTMYPSSLQAERLKKHLKKFPGAIPARNNWKTQKLWAKLRENPDLIESEDGSDISFGPSSEDSVEEVREGRHSHPPTNL
PTPASTRILRKYSNIRGKLRAQRLDSSLCGASEMKQGRKSVCINPLMSPKLALQVGADGFPVNPKRAERSKGRRGKQMPETLLKVEGQNKRKRAEGSGTQDGKDKGPATK
VSRGLSAKKLAAKDRANQLSKKMTLKANKVRVCRKGPGRSCLSSRKEKENANRRPGHPAAASEALTKPSKQRGAREASSKPPKVRRRNRKLSSGRGHARPLAKSPENRTA
PRKRKLKAKLDSSQGKRRRLEAK*
188 >lcl|XP_003085302.1|Plus11155153..1155329 NT_039702 DNA-directed RNA polymerases I, II, and III subunit RPABC4-like LOC100046796 __SEG__ ChrX {Mus musculus} MDAQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR*
189 >lcl|XP_003085372.1|Plus168707549..68709126 NT_078297 zinc finger protein 648-like LOC100503355 __SEG__ Chr1 {Mus musculus} MAQVDSQDRWTKVPLGSTQMLRMSLESEEEDGRKGGSPGTQNNTDSQFDTQSCKEEENWPECFSAGCVAQKPGEMPGKTSNGGKKASRITQIRDSPKLQEALGAPSRSLL
HKVQIQPLRDSVGSDGGKKANKDPASEVPNSFLDSGGYFEAQNSVEASSLDKNSLEHFPRSESTLVQTPTIPASLLVKVRSSRKVQGQAGPEGSGQEEEGLDRCVRAFQK
STKVQVPAEHHGSKPYVCQLCGKAYSHRSTLQQHRRLHTGERPYRCPFCDKAYTWSSDHRKHIRTHTGEKPYGCPDCGRAFVRSSDLRKHQRNMHSNDKPFPCAQCGLTF
NRPLSLLRHQRTHLGAKPFRCSSCGREFSVASRMVEHQRVHSGERPFPCSTCGKCFTKSSNLQEHQTLHTGQRPFKCTDCGVTFAQPSRLLRHQRIHTGERPFPCAECGQ
AFARSSTLKRHQQIHSGDKDFLCAECGRAFRIASELAQHIRMHNGERPYQCEGCGQTFTRSSHLQRHQAKHDTCKKEPVPSSSDE*
190 >lcl|XP_003085376.1|Plus150603703..50604269 NT_078297 achaete-scute homolog 5-like Ascl5-ps __SEG__ Chr1 {Mus musculus} MNSNFCRALVDRGPPGGMQLGVVAPAGQTPLAATEPLSNVPFLLYPGHSEPPYYDAYTGVFPYVPFPGAFGVYDYPFEPAFIQKRNERERQRVKCVNEGYARLRGHLPGA
LTEKRLSKVETLRAAIRYIKYLQELLSATPDGAPPPATSPPPAHTGHSNVPQPSSLVAESSGSPFSSSPFLESEEPSL*
191 >lcl|XP_003085403.1|Plus110189198..10189374 NT_078458 DNA-directed RNA polymerases I, II, and III subunit RPABC4-like LOC100503231 __SEG__ Chr5 {Mus musculus} MDAQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYRKRTKRLVVFDAR*
192 >lcl|XP_003085487.1|Plus1complement(33978996..33980558) NT_109320 zinc finger protein 709-like LOC100504155 __SEG__ Chr5 {Mus musculus} MWQSFTCANYLCRHKRSPTGEKPNEYTQCGKAFACHSYPQRYGRIHIGEKPYGESFAPTSGLQICKIIHTGEKPYKCNQCGKAFARLSYLQMHKITHSGQKTYKCDQCGK
AFAYPGYLQVHKRTHTGEKPYECKQCSKAFAFPGHLQRHERIHTGEKPYKCSDCGKAFAFNTNLRVHKATHTGEKPYECKQCSKSFASHGQLHYHERIHTGEKPYKCNQC
DKAYTRHSHLQMHKTTHTGEKTYKCNQCGKAFAYHSYLQVHKRIHTGEKPYECNQCGKAFVCPGHLQRHKRTHTGEKPYECNQCGKAFTYHGHLQIHKRTHTGEKPYECD
QCGKAFAYPGYLQVHKRTHTGEKPYECDQCGKAFASHGYLQVHKRTHTREKPYECDQCGKAFASHGYLQVHKRTHTGEKPYECNQCGKAFAGQNVLKRHKRTHTGEKPYK
CNECGKAFAFNTKLQIHKTTHTGEKSYECKQCSKSFASHAQLQYHERIHTGEKPYKCNQCGKTYSQSSDLQVHKRTHTRV*
193 >lcl|XP_003085492.1|Plus1829518..829955 NT_109320 zinc finger and SCAN domain-containing protein 20 2310040G07Rik __SEG__ Chr5 {Mus musculus} MESGPGKHWTEEEVKALLSVWAERNIRKQLYRTLRNKEIFIYVAKRLQTLGVYRDWKQCRAKYKNLKYEYRTVKHAHRSGDSSRTMKFFHALDAILQSEPTARLAEEDGC
CSKCLATLSPVTAPEITEGKKENLHSFVCHCVYSF*
194 >lcl|XP_003085493.1|Plus1complement(17291749..17294190) NT_109320 histone acetyltransferase KAT2B-like LOC100504388 __SEG__ Chr5 {Mus musculus} MVEAGRAGPPALPPAPPHGSPWTLATTAGSSASCGPATTVAAAGMSKGPGGGDSAWIAEKKAQLHSAPLAKKLEKLSVYSACNAEESCKCNGWKNPNPSPIPPRGDLQQL
IVNLTESCRSCSHALDAHVSHLDNVSEEEMNRLLGIVVDVEYLLTCVHKEDDADTKQVYFYLFKLLRRSVLQRGKPVVEGFLEKKPPFEQPSIEQGVNNFVQYKFSHLPS
KERQTTIQLAKMFLNRINYWHLEAPSQRRLQAPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTKVFGRTLLRSIFTIMRRQLLEQARQEKDKLPLEERTLILTHFPK
FLYMLEEEVYSQNSPIWDQDFLSASSRTSSLGIQTVVCPPVTRKALFSSNSTSHEQINGGRTSPGCRSSSGLEANPGKKRKMNNSHVPKETKRSRVMGDIPVELINEVMS
TITDPAGMLGPETNFLSALSARDEAARLEERRGVIEFHVVSNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFQMFPSQGFT
EIVFCAVTSEEQVKGYGTHLMNHLKEYHVKHEILNFLTYADDHAIGYFKKQGFSKEIKIPKTKYAGYIKDYEGATLMGCELNPHIPYTEFSVIIKKQKEITKKLTERKQA
QIGKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSRKEKSKEPKDPEQLYSTLKNILQQVKSHQSAWPFLEPVKRTEAPGYYEVIRFPMDLKTMSERLRNRYYVSKKLFM
ADLQRVFTNCKEYNPPESEVYKCASILEKFFFSKIKEAGLIDK*
195 >lcl|XP_122081.5|Plus124748476..24749132 NT_039500 transcription initiation factor TFIID subunit 10-like Gm4799 __SEG__ Chr10 {Mus musculus} MSCSGFGADPEAAPACAALVAGPAPPVSAPPALPTSTAAESKASPAGTAGGPVAGVATAGTGPVVARAGEPAELRGPASVAAGGVAPPEGAMSNGVYVLPSAANGEVKPV
VSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQRCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT*
196 >lcl|XP_205276.3|Plus110790602..10795113 NT_039700 hypothetical protein LOC278181 Gm5073 __SEG__ ChrX {Mus musculus} MSSRKKRSSLGGQQFAEGDNFVKLKPHDRRARKARSVSSPRKSTESRSLQPTLQRRLRGRSVKKRHLVENGYSEEKTYTGEKIPSTEKNSSTEKRCSLAEKYHTTVKSSS
AEKLLLVEKHPYADKSLTRKKRSSAEKHSPTEKGRMTQKSSSGGRRHSETHQSGKSPHFSEECQITEKRHSSVKHGSSDKDHPADRGRPINKRHSSEKRQSTEKGQLTGR
SPYAPANERGRPTKKGQPTEKGLSTKKGPDTENRHPAKKGYSAKTLSSAERDSQIERGSATGSRLSTEKDCLSGRGWPAKKSHLAEKGHSEKSSCALRGTSAGKDRSAGR
VHSNTRGPAEEGHPVKCICESSVPSAGKDQPARSRPNKSIPREESHPVENEICLSTGPSEGRGSPNKIRRAEKGHSVKIGNSMSRRPSAGKDRSGGRGRPIKTGCAEESR
SVKGGSSASRGSSTGKERPVRRGRPGKIRRADNGPSIENGSSTSRRPSAGKDRSGGQGCPNKSGHAEESWSVEGGSSTSRSPPTGKERPVRRCVSNSRSPAEQWCSIKCG
ICATSVPSVGKDRSGIRGCPNKRGSAEEDHSVKGSSSTSRGTSVGKDHPAKRSRSTKSGPTEEGCSVKNGSYASRGTSAGKDRSGGQGCPHKRGPAEDSHSVKGSSSTSR
GSSTEKERPVRRGRLGKIRRADNGRSVENGSSTSRRPSAGKDRSGGQGYPNKSGHAEESLSVEGGSSTSRAPPTGKERPVRRCVSNSRSPAEQWCSIKCGICATSVPSVG
KDRSGERGGPNKRGLAEEGHSVKGSSSTSKGSSVGKDRPVRRGCPSKIRRADNVHLVKNGSSTSRRPSAGKDRSGGQVCPNKSGHAEKSWSVECGSSTSRAPCTGKERPV
RRCVSNSRSPAEQWCSIKCGICATGVPFAGKDRSGERGGPNKRGPAEEGHSVKGSSSTSRGSSVGKDRPVRRGCPSKIRRAHNVHLVENGSSTSRRPSAGKDRSGGQVCP
NKSGHAEESWSVEGGSSTSRSPPTGKERPVRRCVSNSRSPAEQWCSIKCGICATSVPFVGKDRSGVRGYPNKRGPAEEGHSVKGSSSTSRGPSVGKEHPIGRGRPPKKSR
HEKDSCSAEKGNHADKGPSAGKDHPTGRGQPQKKSHPAEAGHLVEKGSSAERGPSVKKDPHTGRGRRRPPKKSHPAERHLSASMKVCPPKKHQPSKQVVCVKRVRSAERV
HSMERGHLAKKSCPAERQLSAEEGSIAESGCSFEKDLSGERAHSSQRSCTAEERSEEGNMHSVEKGHPSMETGFREEKSSSGSMSKATEPNNLQSPPENRIGSETNQVAQ
VPHRNMPATVKIKMGVELKLPDELKFRLVEDWDLVNKQNQLFQLPAEKTVDTILAEYVTFVKSQDLGDNREYSVDEVVFGIREYFNKMLGTQLLCKFEKPQYAEIHLAYP
GIPMSQVYGAPHLLRLFVKIGTALAHSPLNRQSLLLVSSYMHDFLEYLAEKSTSLFTVSNYKVASAEYCCKAL*
197 >lcl|XP_285437.4|Plus1complement(11081011..11085522) NT_039700 hypothetical protein LOC331391 Gm5123 __SEG__ ChrX {Mus musculus} MSSRKKRSSLGGQQFAEGDNFVKLKPHDRRARKARSVSSPRKSTESRSLQPTLQRRLRGRSVKKRRLVENGYSKEKTYTGEKIPSTEKNSSTEKRCSLAEKYHTTVKSSS
AEKLLLVEKHPYADKSLTRKKRSSAEKHSPTEKGRMTQKSSSGGRRHSETHQSGKSPHFSEECQITEKRHSSVKHGSSDKDHPADRGHPINKRRSSEKRQSTEKGQLTGR
SPYAPANERGRPTKKGQPTEKGLSTKKGPDTENRHPAKKGYSAKTLSSAERDSQIERGSATGSRLSTEKDCLSGRGWPAKKSHLAEKGHSEKSSCALRGTSAGKDRSAGR
VHSNTRGPAEEGHPVKCICESSVPSAGKDQPARSRSNKSIPREESRPVENEICSSTGPSEGRGSPNKIRRAEKGHSVKIGSSMSRRPSAGKDRSGGRGRPIKSGCAEESR
SVKGGSSASRGSSTGKERPVRRGRPGKIRRADNGPSVENGSSTSRRPSAGKDRSGGQGCPNKSGHAEESWSVEGGSSTSRSPPTGKERPVRRCVSNSRSPAEQWCSIKCG
ICATSVPSVGKDRSGVRGGPNKRGSAEEDHSVKGSSSTSRGSSVGKDHPAKRSRSTKSGPTEEGCSVKNGSYASRGTYAGKDRSGGRGCPHKRGPAEDSHSVKGSRSTSR
GSSTGKERPVRRGRLGKIRRADNGRSVENGSSTSRRPSAGKDRSGGQGYPNKSGHAEESWSVEGGSSISRAPPTGKVRPVRRCVSNSRSPAEQWCSIKCGICATSVTSVG
KDRSGERGGPNKRGLAEEGQTVKGSSSTSKGSSVGKDRPVRRGRPSKIRRADNVHLVENGSSTTRRPSAGKDRSGGQGCPNKSGHAENSWSVECGSSTSRAPCTGKERPV
RRCVSNSRSPAEQWCSIKCGICATSVPSVGKDRSGERGGPNKRGPAEEGHSVKGSSSTSRGSSVGKAHPVRRGRPSKIRRAHNVHSVENGSSTSRRPSAGKDRSGGQGCP
NKSGHAEESWSVEGGSSTSRAPPTGKERPVRRCVSNSRSPAEQWCSIKCGICATSVPSVGKDRSGERGGPNKRGPAEEGHSVKGSSSTSRGPSLGKEHPIGRGRPPKKSR
HEKDSCSAEKGNHADKGTSAGKDHPTGRGQPRKKSHPAEAGHLVEKGSSAERGPSVKKDPHTGRGRLRPPKKSHPAERHLSASMKVCPPKKHQPAKPVVCVKRVRSAERV
HSMERGHLAKKSCPAKRQLSAEEGSMAERGCSFEKDLSGERAHSSQRSCTAEERSEEGNMHSVEKGHPSMETGFREEKSSSGSMSKATEPNNLQSPPENRIGSETNQVAQ
VPHRNMPATVKIKMGVELKLPDELKFRLVEDWDLVNKQNQLFQLPAEKTVDTILAEYVTFVKSQDLGDNREYSVDEVVFGIREYFNKMLGTQLLCKFEKPQYAEIHLAYP
GIPMSQVYGAPHLLRLFVKIGTALAHSPLNRQSLLLVSSYMHDFLEYLAEKSTSLFTVSNYKVASAEYCCKAL*
198 >lcl|XP_357814.6|Plus1complement(7856154..7856645) NT_039433 transcription factor BTF3-like Gm5341 __SEG__ Chr7 {Mus musculus} MKEPIMNQEKLAKLQAQVRIGGKGTARRKKKVVQRTATADGKKLQFSLEKLGVNNITGTEEVNMFTNQGTEIHLNNPKVQASLAANTFTITGHAETKQRTTMLPSFLNQL
DADGLTCLRSRAKALPKQSVDRKAPLATTGQEEEDEVPGLGENFDEASENEAN*
199 >lcl|XP_484312.1|Plus111354979..11356433 NT_039590 ETS translocation variant 1-like Gm5454 __SEG__ Chr13 {Mus musculus} MDGFYDQQVPYVVTNSQRGRNCTEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQFVPDYQAESYMFVLFLVAFHGLPLKIKKEPHSPCSELGSAC
SQEQPFKFSYGEKCLCNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNTAHTPKPDRAFPAHLPPSQSIPDSTYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQR
QMSEPNIPFPPQGFKQEYHDPVYEHTTMVGGAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQFYDDTCVVPEKFDGDIKQEPGMY
REGPMYQWRGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFPDNQRPL
LKTDMERHINEEDTVPLSHFDESMTYMPEGGCCNPHPYNEGYVY*
200 >lcl|XP_488332.3|Plus1complement(11048699..11053210) NT_039700 hypothetical protein LOC436196 Gm5755 __SEG__ ChrX {Mus musculus} MSSRKKRSSLGGQQFAEGDNFVKLKPYDRRARKARSVSSPRKSTESRSLQPTLQRRLRGRSVKKRRLVENGYSKEKTYTGEKIPSTEKNSSTEKRCSLAEKYHTTVKSSS
AEKLLLVEKHPYADKSLTRKKRSSAEKHSPTEKGRMTQKSSSGGRRHSETHQSGKSPHFSEECQITEKRHSSVKHGSSDKDHPADRGHPINKRRSSEKRQSTEKGQLTGR
SPYAPANERGRPTKKGQPTEKGLSTKKGPDTENRHPAKKGYSAKTLSSAERDSQIERGSATGSRLSTEKDCLSGRGWPAKKSHLAEKGHSEKSSCALRGTSAGKDRSAGR
VHSNTRGPAEEGHPVKCICESSVPSAGKDQPARSRSNKSIPREESRPVENEICSSTGPSEGRGSPNKIRRAEKGHSVKIGSSMSRRPSAGKDRSGGRGRPIKSGCAEESR
SVKGGSSASRGSSTGKERPVRRGRPGKIRRADNGPSVENGSSTSRRPSAGKDRSGGQGCPNKSGHAEESWSVEGGSSTSRSPPTGKERPVRRCVSNSRSPAEQWCSIKCG
ICATSVPSVGKDRSGVRGGPNKRGSAEEDHSVKGSSSTSRGSSVGKDHPAKRSRSTKSGPTEEGCSVKNGSYASRGTYAGKDRSGGRGCPHKRGPAEDSHSVKGSRSTSR
GSSTGKERPVRRGRLGKIRRADNGRSVENGSSTSRRPSAGKDRSGGQGYPNKSGHAEESWSVEGGSSISRAPPTGKVRPVRRCVSNSRSPAEQWCSIKCGICATSVTSVG
KDRSGERGGPNKRGLAEEGQTVKGSSSTSKGSSVGKDRPVRRGRPSKIRRADNVHLVENGSSTTRRPSAGKDRSGGQGCPNKSGHAENSWSVECGSSTSRAPCTGKERPV
RRCVSNSRSPAEQWCSIKCGICATSVPSVGKDRSGERGGPNKRGPAEEGHSVKGSSSTSRGSSVGKAHPVRRGRPSKIRRAHNVHSVENGSSTSRRPSAGKDRSGGQGCP
NKSGHAEESWSVEGGSSTSRAPPTGKERPVRRCVSNSRSPAEQWCSIKCGICATSVPSVGKDRSGERGGPNKRGPAEEGHSVKGSSSTSRGPSLGKEHPIGRGRPPKKSR
HEKDSCSAEKGNHADKGTSAGKDHPTGRGQPRKKSHPAEAGHLVEKGSSAERGPSVKKDPHTGRGRLRPPKKSHPAERHLSASMKVCPPKKHQPAKPVVCVKRVRSAERV
HSMERGHLAKKSCPAKRQLSAEEGSMAERGCSFEKDLSGERAHSSQRSCTAEERSEEGNMHSVEKGHPSMETGFREEKSSSGSMSKATEPNNLQSPPENRIGSETNQVAQ
VPHRNMPATVKIKMGVELKLPDELKFRLVEDWDLVNKQNQLFQLPAEKTVDTILAEYVTFVKSQDLGDNREYSVDEVVFGIREYFNKMLGTQLLCKFEKPQYAEIHLAYP
GIPMSQVYGAPHLLRLFVKIGTALAHSPLNRQSLLLVSSYMHDFLEYLAEKSTSLFTVSNYKVASAEYCCKAL*
201 >lcl|XP_889413.1|Plus1complement(9017203..9017850) NT_039590 high mobility group protein B1-like Gm6115 __SEG__ Chr13 {Mus musculus} MGKGDPKKLRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAIADKARYEREMKTYIPPKRETKKKFKDPNAPKRPPSAFFLFCSGYR
PKIKGEHPGLSIGDVAKKRGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE*
202 >lcl|XP_892736.1|Plus118519064..18519438 NT_096135 transcription initiation factor TFIID subunit 13 Gm11189 __SEG__ Chr11 {Mus musculus} MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELHCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEEL
KRARKAFDEANYGS*
203 >lcl|XP_895065.1|Plus117272727..17272930 NT_039264 DNA-directed RNA polymerases I, II, and III subunit RPABC5 Gm13015 __SEG__ Chr4 {Mus musculus} MIIPVRCFICGKTVGNKREAYLGLLQAEYTEGDALDALGLKRYCCRRTLLAHVDLIEKLLNYAPLEK*
204 >lcl|XP_899406.1|Plus134711725..34712696 NT_039687 predicted gene 6747 isoform 2 Gm6747 __SEG__ Chr19 {Mus musculus} MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKT
KKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAG
IKEYFNVMLGTQLLYKFERPQYAEILTDHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV*
205 >lcl|XP_902419.3|Plus123834579..23834785 NT_039625 hypothetical protein LOC622794 Gm6358 __SEG__ Chr16 {Mus musculus} MCYYGSYYGGLGYGYGGLGYGYGGLGYGYGGLGYGYGCGCGYGCGYGGYGYGCCRPLCCRRYCSYGFY*
206 >lcl|XP_902548.1|Plus123936164..23936328 NT_039625 hypothetical protein LOC622998 Gm6381 __SEG__ Chr16 {Mus musculus} MCYYGGYYGGLGYGYGGLGYGYGCGCGYGCGYGGYGYGCCRPLCCGRYWSYGFY*
207 >lcl|XP_977911.1|Plus171708..73228 NT_039461 hypothetical protein LOC664808 Gm7349 __SEG__ Chr8 {Mus musculus} METSSEAGVLQKLLDRLCQETDPGKIYKTLKKMSSLPSLCDCLAEIGFRETIKSLKKQQLLVPFVKDLVAQWSTGFLLGPHPEQARQDFDLEKGLTTEGRSTSPEEKPQE
QASQEVRGHGKEVFLGLCSCCPGSSSCLSQSRKSHQRSNRRAPHIRSPHPGENWSPELQQDVQNLMHLGMSRASLEEPWQQEGAKPLSRKPGAGPQEPTGLVFGGHRKCQ
PPGNWEQEEAPGAGSSWACLNWECCSPSSSEQPRGKRQRWEPPCPAEAQSPPAKVPRDESGSSMDLSPIAASTIPETPSRSQAWLEWDLAQETFSSQQDQEASAWMWELR
KQHRTQVYSGCRPAAGPQQKSTGNRDGAHCQAGKDKVGLGQPEEKSWPQGHRCKESYSQPEAPRVLQLQGSHWERMQTVIGRLQSTRAKRPQPRQTMMVSFITELKSPSQ
QGQPGPTGAASAQNPHSLPEAPAHPPVQRASCLLLGERGTKKGPAKRPAPLMAKALKDYRKCFYKR*
208 >lcl|XP_984466.1|Plus12534142..2534585 NT_039515 endothelial differentiation-related factor 1-like Gm11964 __SEG__ Chr11 {Mus musculus} MAESDWDTVTVLCKKGPTAAQAKSKQAILAAQRREDVETSKKWAAGQNKQHSITKNTAKLDWETEELHHDRVALEVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYES
GRAIPNNQVLGKTERAIGLKLRGKDVGKPIEKGPKAE*
209 >lcl|XP_987724.2|Plus114003635..14004648 NT_039482 zinc finger protein 660-like Gm8008 __SEG__ Chr9 {Mus musculus} MQRKTGKFKHKTFEDSKSPTEGSDPEHENSGPQFCASMTGKRGHGERRQFVCTECGKAFSQSANLTVHERIHTGEKPYKCKECGKAFSHSSNLVVHRRIHTGLKPYTCSD
CGKAFSGKSHLSRHQEVHSGEKTHKCKECGKAFSRSSGLISHHRVHTGEKPYTCIECGKAFSRSSNLTQHQRMHRGKKIYKCKECGKTCGSNTKIMDHQRIHTGEKPYEC
AECGKAFIFRKALNEHQRLHRREKPYKCNECGKAFTSNRNLIDHQRVHTGEKPYKCNECGKTFRQTSQVILHLRTHTKEKPYKCSECGRAYRYSSQLIQHQRKHNEEKET
LLFTSQV*