SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab K    

ID / Description / Sequence
1 >lcl|NP_001137270.1|Plus1complement(18400774..18401535) NW_001867392 major prion protein PRNP __SEG__ Chr22 {Equus caballus} MVKSHVGGWILVLFVATWSDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGSHGQWNKPSKPKTN
MKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVSEYSNQNNFVHDCVNITVKQHTVTTTTKGENFTETDVKIMERVVEQMCITQY
QKEYEAFQQRGASVVLFSSPPVVLLISFLIFLIV
2 >lcl|NP_001139637.1|Plus1complement(25540906..25541547) NW_001867413 twist-related protein 1 TWIST1 __SEG__ Chr4 {Equus caballus} MMQDVSSSPVSPGRRQPEQQRRGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSWAKHSKKLY*LRQSSRSAASIKQGAAGSLQS
YGGAAVATGSCPTCGKRQRHAGR*KRRRSPRCGRSSPPLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH*
3 >lcl|XP_001487974.1|Plus112856427..12857422 NW_001867424 neurogenic differentiation factor 4-like LOC100053133 __SEG__ Chr6 {Equus caballus} MAKTYVKPKEMTELVNTPSWMDKGLGSQNEMKEEERRSAVYGILGSLAEEHDSIEEEDDEEEDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNL
RRVMPCYSKTQKLSKIETLRLARNYIWALSEVLETGQTPEGKGFVEMLCKGLSQPTSNLVAGCLQLGSQSVLLEKHEEKSPICDSAISVHNFNYQSPGLPSPPYGHMETH
LINLKPPVFKNLGESSFGSHPPDCSTPPYEAPLTPPLSISGNFSLKQDGSPDLDKSYSFMPHYPSSSLSSGHVHSTAFQAGTPRYDVPIDMSYDSYPHHGIGAQLNTIFT
D*
4 >lcl|XP_001488130.1|Plus1complement(48220815..48221453) NW_001867387 high mobility group protein B1-like LOC100050136 __SEG__ Chr1 {Equus caballus} MGKGEPKKPRGRMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYR
PKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKIKKKKEAEEDEEDEEDEEEEEVEDEEEDYDDE*
5 >lcl|XP_001489012.2|Plus19361915..9363060 NW_001877040 transcription elongation factor A N-terminal and central domain-containing protein-like LOC100050408 __SEG__ ChrX {Equus caballus} MLLSGNCDWQVQASENGNLFSLFFAAVKMSDKNQIAARASLIEQLMAKRNFEDLGNHLTELETLCVTKKHLQETDVVRAVYRVLKNCPTVALKKKAKCLLKDWKALYKDI
HFKPRDSPQLFPLGGNKEENSGLSHDPSQDEILGVSSSDSLLSSQDVMAKATEMIVPENSSSPVEPKEGHFRGGDPESTDSRSSELLDPAVPVRTKCTQLLYEALTSSST
HQPKADLWQNFAREIEEHVFALYSKNLKKYKTCIRSKVANLKNPKNSHLQENLLSGALSPREFAEMSVMEMASKELKQLRACYTESCIQEHHLPQVMEGSQTKKIKCRRC
EKFNCQVTVIARGTLFLPSWVRNSNPDEEMMTYVICNECGEQWYHSKWVCL*
6 >lcl|XP_001489539.1|Plus1complement(2299575..2300252) NW_001867387 zinc finger protein 22-like LOC100054270 __SEG__ Chr1 {Equus caballus} MRLGKPKGGISRSSSHGKASENQRKTIRQRQKWGMTVPFISNLSRLRRSLDEKPYKCTECEKSFSQSSTLFQHQKIHTGKKSYRCADCGKSFFQSSNLIQHRRIHTGEKP
YKCDECGESFKQSSNLIQHQRIHTGEKPYQCDECGRCFSQSSHLIQHQRTHTGEKPYQCSECGKCFSQSSHLRQHMKVHKEEKPRKTRGKNIRAKTHSVSSWKAGTGRKS
VARLR*
7 >lcl|XP_001489569.1|Plus1complement(22708128..22709048) NW_001867398 zinc finger protein 42 homolog LOC100055254 __SEG__ Chr27 {Equus caballus} MDQQLKKRAKTQDGKGLDRRAIVAGDKPQRAQASPARQESLDMTWALGGEDVYCETCHQLVGEDSFCDCYIECIIRGEFSEPILEEDLLLKSFDCLTEGSEQDLSQQLLT
ASSLLECSLEYVKKGAKQDLPQETVGENSLLGYPEYMTGKRLPPGGISSVDLPDPQQLSESARKKPGKNQECDAPEKIVCPQSGCTKKLKNKASLRKHLLVHGPRDHVCA
ECGKAFNESTKLKRHFLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGEKRFMCPFEGCHKRFIQSNNMKVHILTHAKTKGNQ*
8 >lcl|XP_001491525.2|Plus1complement(502708..503109) NW_001867419 helix-loop-helix protein 1-like LOC100058552 __SEG__ Chr5 {Equus caballus} MMLNSDSMELELPPTHSETESGFSDCGGGAGPDGAGSGGPGGGPARGLEPGEPGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKK
LSKIEILRLAICYISYLNHVLDV*
9 >lcl|XP_001491919.1|Plus12728234..2729580 NW_001867428 zinc finger protein 70 ZNF70 __SEG__ Chr8 {Equus caballus} MEVSPAAKLGETFVFEDGLEMQPELFPEEDLADPFLRERGLEQMAVIYKEIPLGEQDEEHDDYEGNFSLCSSPVQHQSISLVNRDQDDEIFGQTLLQKSDLSMCQIIHDG
EEPSKQDCEKAGRGDLGPHEPHRTAQPTKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECQECGKAFRQSSALTQHRKTHT
GKRPYECRECGKDFSRSSSLRKHERIHTGEKPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRIHTGKKPYKCEECGKAFSQSSNLIEHRKT
HTGEKPYKCHKCGKAFSQSSSLIEHQRIHTGEKPYECSQCGKAFCHSSALIQHQRIHTGKKPYACNECGKAFRHRSALIEHYKTHTREKPYECNRCGKAFRGSSHLIRHQ
KIHAAEKL*
10 >lcl|XP_001493273.1|Plus116374868..16375959 NW_001877040 transcription factor YY2-like LOC100051735 __SEG__ ChrX {Equus caballus} MASEEALYISTENSEMPADIVELHSLPVETAEMGTVEYEDISGDWFHGGHHHPPLIALQPLIINNPNQGDQEMVMVQTQEEVVDYYESDNLENPVINPVDDDDYYQQALA
SLATSASSSAYSYRKKRRSRGKKPGHKKSYTSSEARAGSGSAPETGRKKWEQKQVHIKTLEGEFSVTMWCPSSERDNETEGQTEENSPPDYSEYVTGKKLPPEGIPGVDL
SDPKQPAEFTGMKPRKKKEGTPKTVACPHKGCEKMFRDNSAMRKHLQIHGPRVHVCAECGKAFLECSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDR
PYVCPFDACNKKFAQSTNLKSHIITHAKNKSSQ*
11 >lcl|XP_001493288.1|Plus1complement(7899349..7899762) NW_001867419 cornifin-A-like LOC100061206 __SEG__ Chr5 {Equus caballus} MSSYQQKQPCTLPPQPQEQQVKQPCQPPPQEPCFPNTKEPCDIIIPQPDNTKFPQPGNIKVPQPGDAQFPQPGNIKVPEPCYPKYPEPGQSTFPEQGHPKFPEAVYPKEP
LPGQSKFPEPYPITVIPGPIEPGTKQK*
12 >lcl|XP_001493382.3|Plus1complement(1546044..1546826) NW_001877046 mortality factor 4-like protein 2-like LOC100054360 __SEG__ ChrX {Equus caballus} MQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEVFKNRMEVKVKIPEELKPWLVEDWD
LVTRQKQLFQLPAKKNVDAILEEYADCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKS
LALLLGYLHDFLKYLAKNAASLFTASDYKVASAEYHRKAL*
13 >lcl|XP_001493449.1|Plus111725381..11725698 NW_001867396 t-cell acute lymphocytic leukemia protein 2-like LOC100054151 __SEG__ Chr25 {Equus caballus} MTRKIFTNTRERCRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLREQSLQPTAVAAQGNILGLFHQGPHLPDRTLLGDYQLPLPGPSHHIP*
14 >lcl|XP_001493587.1|Plus11465899..1466588 NW_001877046 transcription elongation factor A protein-like 4-like LOC100053925 __SEG__ ChrX {Equus caballus} MEKLCTENEEMPENQGKMENKEQPLDMGKPEVACSLEDKEKLENEGKTDHEGKTEDEEVLNDKEKPESEAKPEEGEKAESHGKPENQGKPVSQGKPKEEGKPETQGNPES
QGKPKEEEKPASEPKAAGKRPAGDDVPRKAKRKTNKGLAQCLKEYKEAIHDMHLSNEEMIREFDEMARVEDEVKKTRQKLGGFMWMQKSLQDPFHPRGPRELRGGCRAPQ
RGFEDIPFV*
15 >lcl|XP_001494069.3|Plus17355927..7356805 NW_001867363 zinc finger protein OZF-like LOC100060655 __SEG__ Chr10 {Equus caballus} MSHLSQQRICSGGNPFACKVCGKVFSHKSNLTEHEHFHNREKPFECNECGKAFSQKQYVIKHQNTHTGEKLFECNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKAFI
QKSNLIRHQRTHTGEKPFVCKECGKTFSGKSNLTEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTGEKPYECNECGKAFSQRTSLIVHVRIHSGDKPYECNVCGKA
FSQSSSLTVHVRSHTGEKPYGCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQKSHHIRHQKIHTH*
16 >lcl|XP_001494160.3|Plus18584784..8586085 NW_001867363 zinc finger protein 569 ZNF569 __SEG__ Chr10 {Equus caballus} MSNLIRHQRIHTGEKPYACKECGKSFSQKSNLIDHEKIHTGEKPYECNECGKAFSQKQSLIAHQKVHTGEKPYACNECGKAFPRIASLALHMRSHTGEKPYKCDKCGKAF
SQFSMLIIHVRIHTGEKPYECNECGKSFSQSSALTVHMRSHTGEKPYECKECRKAFSHKKNFITHQKIHTREKPYECNECGKAFIQMSNLVRHQRIHTGEKPYICKECGK
AFSQKSNLIAHEKIHSGEKPYECNECGKAFSQKQNFITHQKVHSGEKPYDCNECGKAFSQIASLTLHLRSHTGEKPYECDKCGKAFSQCSLLNLHMRSHTGEKPYVCNEC
GKAFSQRTSLIVHMRGHTGEKPYECNKCGKAFSQSSSLTIHIRGHTGEKPFDCSKCGKAFSQISSLTLHMRKHTGEKPYHCNECGKAFSQKSHLVRHQRIHTH*
17 >lcl|XP_001495103.2|Plus113449838..13450884 NW_001867398 purine-rich element-binding protein gamma isoform 1 PURG __SEG__ Chr27 {Equus caballus} MERARRRGGGGGGRGRGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLSL
SVAAELKDCLGDFIEHYAHLGLKGHRPEHGHGKEPGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMLRGTGMIGYFGHSLGQE
QTIVLPAQGMIEFRDALVQLIEDYGEGEMEERRGGDDDQLELPEGTSFRVDNKRFYFDVGSNKYGIFLKVSEVRPPYRNTITVPFKAWTRFGENFIKYEEEMRKICNSHK
EKRMDGRRASGEEQECLD*
18 >lcl|XP_001495547.1|Plus1complement(4613565..4614392) NW_001867427 nuclear factor interleukin-3-regulated protein-like LOC100064660 __SEG__ Chr7 {Equus caballus} MDVGPLGLPELTQGCSKTLRGARGRGPAMRRQREFMPEEKKDTVYWEKRRKNNEAAKRSREKRRLNDAALEDRLASLLEENALLRAELRALKHRFGLLPSAGGTRTLPLQ
ALLWESWMGDSCPGAEPLPSLPGSHGCVFRPCSLDAGVPGCWGCPVAQRWTDLATSPAPSTPKRVDMALQAALPAAFFGCQLLDGHGGPRPELRPCWGLWSPMPSSRRAS
GPSDVLLTPTADPMGLPSGNDPEGLAKPSLPHKLRIKSRASGRVPRGWEGGRGPL*
19 >lcl|XP_001495684.1|Plus1complement(27592528..27592707) NW_001867397 hypothetical protein LOC100064868 LOC100064868 __SEG__ Chr26 {Equus caballus} MSYYYGNYYGGLGYGLGGLGCGYGCFRGLGCGYGAGYSGYGYGCYRPCYYGRYWSSGFY*
20 >lcl|XP_001496934.1|Plus1complement(24027812..24028444) NW_001867427 putative RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like protein 1-like LOC100066687 __SEG__ Chr7 {Equus caballus} MPSSPLKVAVVCVSNMNRSMEAHSILKKKAFSVWSFRTGSRVRLPGEAPNLPVAYYFSTTYKEMYNDLLRKDRQHYTRNGMLHILGRNERIKPRPERFQECCEAFDVIFT
CGESIHDRVVEDLCAREQETFQPVHVINVDIQNTPEDATLGALLICELCQCLQHMDNMEDSLAKLLLAVEEKRGKKFLHGGCFCCRAGLVLAPGSVRTCA*
21 >lcl|XP_001497086.1|Plus1complement(25572327..25572800) NW_001867413 fer3-like protein-like LOC100053221 __SEG__ Chr4 {Equus caballus} MAAYPESCVDATVLDFVADLSLASPGRPLLCGFAPGVPFGDRDGRPRRLARFEEEDPEDDEGEVDEEEEEEEHGRGASLLGRPKRKRVITYAQRQAANIRERKRMFNLNE
AFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLESCEKKETG*
22 >lcl|XP_001497266.1|Plus110280670..10281857 NW_001867403 DNA-directed RNA polymerase III subunit RPC4-like LOC100052422 __SEG__ Chr2 {Equus caballus} MSEGNAAGEPSAPGGSRPLGAPGAHRRRPAPPLTPGRLPSICSRDLTLGGVKKKTFTPNIISRKIKEEPEEEVTIKKEKPERDRDRQREGHGRGRGRPEVIQSHSVFEQG
PAEMMKKKGNRDKTVDVSDIGPSHIINSKKEKRETDEETKQILRMLEKDDFIHDPGLRNDTRNMPVQLPLAHSGWLFNKENEEPDVKPLLAGPKEEDVEVDVPVLKVKEE
PRAKEEEAKVKAPRAAGKTPGLPKDVSVAELLRELSLAQEEELLFLQLPDTLPGQPPTQDIKPIKTEVQSEDGQTVVIKREKDREARLAENACTLADLSEGQVGKLLIRR
SGKVHLLLGKVTLDVTVGTACSFLQELVSVGLGDSRTGEMIVLGHVNHKLVCSPDFESLLDHKHR*
23 >lcl|XP_001497341.2|Plus1complement(15607947..15608795) NW_001867402 zinc finger protein 691-like LOC100067184 __SEG__ Chr2 {Equus caballus} MGSEKEQTPEQHLPEEGERGKPWRVDDSEGLRIPDGEKEHGQESLSEGPQGIQPKKQKVTVPAGEPGDPIAHPRPEADEKPFICAQCGKTFNNTSNLRTHQRIHTGEKPY
KCSECGKSFSRSSNRIRHERIHLEEKHYKCPKCQESFRRHSDLTTHQQDHLGKRPYRCDICDKSFSQSATLAVHHRTHLEPAPYICCECGKSFSNSSSFGVHHRTHTGER
PYECAECGRTFSDISNFGAHQRTHRGEKPYRCTLCGKHFSRSSNLIRHQKTHTGEQAGKDSS*
24 >lcl|XP_001498351.2|Plus1complement(22852117..22853109) NW_001867392 forkhead box protein S1-like LOC100068461 __SEG__ Chr22 {Equus caballus} MQQQPPPGPLAPAAEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRR
RRRFTRRAGAEGAKGPAKARRGPLRASSQDPGVSDAATGRQCPFPPELPEPKGLSFGGLVGALPASMCPPTTDARPRPPAEPKEMPTPKPAGPGEFPVATSSSPCPAFGF
PAGFSEAEGFSKAPTPILPPEAGIGSSYQCRLQALNFCVGPDSGLEHLLASAAPSPAPPTPPASLRAPLPLPADPKEPWVAGSFPVQGGSGYPLGLTPCLYRTPGMFFFE
*
25 >lcl|XP_001498586.2|Plus1complement(29927797..29928954) NW_001867399 mTERF domain-containing protein 3, mitochondrial MTERFD3 __SEG__ Chr28 {Equus caballus} MLWKLLGRCQPCRLCAFRRMLSASQYRPVLAYFPYTTDNRSNKENKRTVEKLYKFSVDIRKIRRLKGWVLLEDETYVEEIANILQQLGADETAVASILERCPEAIVCSPT
AVNTQRGIWQLVCKNEEELVKLIQQFPESFFTVKDQENRKLNIQFFQELGLKNVVISRFLTTASNVFHNPVEKNKQMISILQESYLNLGGSEANMKVWLLKLLSQNPFIL
LNSSVAIGETLEFLQEQGFTNSEILQLVSKLKGFLFQLCPRNIQTSISFSKNAFKCSDHDLKQLVLKCPALLYYSVPVLKERIQGLLKEGISIAQIRETPMVLELTPQIV
QYRIRKLNSLGYRIKDGHLANLNGTRKEFEASFDKIQAKKGRPLFNPVAPLNVEE*
26 >lcl|XP_001498761.1|Plus110712399..10713184 NW_001867429 zinc finger protein 664-like LOC100059210 __SEG__ Chr8 {Equus caballus} MIYKCPMCREFFSERADLFMHQKIHTAEKPHKCDKCDKGFFHISELHIHWRDHTGEKVYKCDDCGKDFSTTTKLNRHKKIHTVEKPYKCYECGKAFNWSSHLQIHMRVHT
GEKPYVCSECGRGFSNSSNLCMHQRVHTGEKPFKCEECGKAFRHTSSLCMHQRVHTGEKPYKCYECGKAFSQSSSLCIHQRVHTGEKPYRCCGCGKAFSQSSSLCIHQRV
HTGEKPFKCDECGKAFSQSTSLCIHQRVHTKERNHLKISVI*
27 >lcl|XP_001498808.2|Plus1complement(35767514..35769805) NW_001867430 transcription elongation factor B polypeptide 3 TCEB3 __SEG__ Chr8 {Equus caballus} MAAGSVRQVVAELQARLATSPDPERLQRDLKRLSAMPISVAILADTGVGKTVNRLCKLEQVGSLARDLVAQWKKLVPVAGNAEPDERVLEKSGPRKRPRDALQKEAEMPG
DHQAHGKASSGPSDGSEHRRRKHKNPPELERPHQESHSRERAEETKKCHRVSPVYSSEQEFSGYGQSPPSAAGPHQTSRDHRGRPAEGHVARQRPGEGHSDASRDRRRLS
QERHLGAPQGEAAVSQSKGHQSSHQDKGPVGAKGQKSSALISRKSQQAFPREDSPRPLFRESAKEKPPSSGLEKEKGREGRRVRKFSPASEVASDHHLKKQKRGDSEKPK
SDQNKPSLDTLDVGKRPGGLLPKVKEKVSSNLKTQDGKVKTSHLDRKPVGSPAEVEEADMDDEFQPPTGSFESYLNYDQPPKKKKKTMKTSATGLKEKGPEKKDSKSTSE
NLNSVQELPKVNENSEKLQPPGADGAELKKVPTDAFPVLPDLPLPSIQASCRALPAFEWMPSFQPKPKALSSPKKEEEAGFTGRRTNSKMQVFSGSKCASLAKMMTLRQQ
CIRVLKNNLDSIFEVGGVPYSVLEPVLESCTPDQLYRIEKYNHVLVEETDELWKIHCRQTFKKERQEEHESWREMYLRLQDAREQRLRELTVNIRSAQADMPKGRQTKMV
LFNSVAKPPSGVPRRQKFGTGGAAVWEKALIKPAPDTTGSSPAPSHSASSNSINLISEKLGSDCPGTTSAQLVQVVSSRKPGKKIAPLMAKTIKDFKKRFSRR*
28 >lcl|XP_001498948.2|Plus1complement(27840513..27840803) NW_001867397 hypothetical protein LOC100052820 LOC100052820 __SEG__ Chr26 {Equus caballus} MCCNYYGNSCGYGCRYDYGCGFGPHYGCSYGTGYGCGYGCGYGPHYGCSYGTGYGCGYGTRYGCSYGSSYGCGYGSGSGYCGYRPFCYRRYYSSCC*
29 >lcl|XP_001499059.1|Plus127657867..27658046 NW_001867397 hypothetical protein LOC100052924 LOC100052924 __SEG__ Chr26 {Equus caballus} MVYYGNCCGGYSYGGLGCGYGCGYPGYGGYGCGYPGYGGYGYGYYRPSCYGRHWTYGFY*
30 >lcl|XP_001499129.1|Plus1complement(27583882..27584100) NW_001867397 hypothetical protein LOC100052975 LOC100052975 __SEG__ Chr26 {Equus caballus} MSYYGSCYGGLGYGYGGFGGLGSGCGCGWGCFHRLGYGCGYGVYGYGSGCGGYGYGCYRPCYYGRYWSSGFY*
31 >lcl|XP_001499141.1|Plus1complement(27534993..27535166) NW_001867397 hypothetical protein LOC100053025 LOC100053025 __SEG__ Chr26 {Equus caballus} MSYYYGNYYGGLGCGLGAFGGLGYGYGSGYGLGGCGGYGCGYFRPSFYGRYWSSGFY*
32 >lcl|XP_001499152.1|Plus1complement(27530076..27530249) NW_001867397 hypothetical protein LOC100053072 LOC100053072 __SEG__ Chr26 {Equus caballus} MSYYYGNYYGGLGYGLGGFSGLGYGYGSGYGLGGCGGYGCGYFHPSFYGRYWSSGFY*
33 >lcl|XP_001499161.1|Plus1complement(27525156..27525329) NW_001867397 hypothetical protein LOC100053114 LOC100053114 __SEG__ Chr26 {Equus caballus} MSYYYGNYYGGLGYGLGGFSGLGYGYGSGYGLGGYGGYGCGYFRPSFYGRYWSSGFY*
34 >lcl|XP_001500061.1|Plus123957893..23958477 NW_001867427 putative RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like protein 1-like LOC100053176 __SEG__ Chr7 {Equus caballus} MPSSPLMVAVVCKSNMNRSMEAHSILRKKGFSVRSFGTGSLVRLPGTARDLPAVYNFTTTYKEMYNDLLRRDRQHYTRNGILHILERNQRIKPRPERFQECREAFDVIFT
CGESIYDRVVEDLCAREQETFQPVHVINVDIQDTLEDATLGALLICELCQHLQHADDMEDSVDKLLLMVEEKRGKSFLHTVCFY*
35 >lcl|XP_001500277.1|Plus1complement(30962713..30965670) NW_001867392 zinc fingers and homeoboxes protein 3 ZHX3 __SEG__ Chr22 {Equus caballus} MASKRKSTTPCMIPVKTVVLQDASAEAQPSEALHEGPQQDLPSEAPATSSEAAQNSSSTDGTALANGHRSTLDGYSYSCKYCDFRSQDITQFMGHMNSEHTDFNKDPTFI
CTECSFLAKTPEGLSLHNAKCHSGEASFGWNVAKLDNHVVVEQSVPESTSTPDLLAEPNAEGTDGQAEIIITKTPIMKIMKGKPEAKKIHTLKENVPSQPVGEALPNPLA
GETEVKEGDHSFVNGAVPVSQASTNSAKTPHVANGPLIGTVPVLPAGIAQFLSLQQQPPVHAQHHAHQPLPTSKSLPKVMIPLSSIPTYNAAMDSNSFLKNSFHKFPYPT
KAELCYLTVVTKYPEEQLKIWFTAQRLKQGISWSPEEIEDARKKMFNTVIQSVPQPTITVLNTPLVANAGNVQHLIQAALPGHVVGQPEGTAGGLLVTQPLMANGLQAPS
SSLPVAVTSIPKQPTVAPINTVCSNTTSAVKVVNAAQSLLTACPSITSQAFLDASIYKNKKSHEQLSALKGSFCRNQFPGQSEVEHLTKVTGLSTREVRKWFSDRRYHCR
NLKGSRAMMAGDHGSILIDSVPEVPFSPSSKAPEVTCIPTAATLATYPSAKRQSWHQTPDFTPTKYKERAPEQLRALESSFAQNPLPLDEELDRLRTETKMTRREIDSWF
SERRKKANAEETKKTDESASQGEEEAAEGEGGEEDLASDLRVLGENGSPETPGNHTLAERKVSPIKINLKNLRVTEANGKSELPGLGTCEPEDDGLSKLAEQPPGRVSYK
KTAQQRHLLRQLFVQTQWPSNQDYDSIMAQTGLPRPEVVRWFGDSRYALKNGQLKWYEDYKRGNFPPGLLVIAPGNRELLQDYYMTHKMLYEEDLQSLCDKTQMSSQQVK
QWFAEKMGEETRAVADTGSEDQGPGDPAAVHKGMGETYSEVSENSESWEPSAPEASSEPFDTPSPQAGLQLGKESMGAMAMLCWYGVGGTHGWALNLLHGGICCF*
36 >lcl|XP_001500752.1|Plus1complement(36047161..36048174) NW_001867413 neurogenic differentiation factor 6 NEUROD6 __SEG__ Chr4 {Equus caballus} MLTLPFDESVVMPESQMCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKKAPGEETEKEEEEEDREEEDENGLPRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGL
NDALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGCLQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELATPP
GHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEESLDYGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFPYDLHLRSQSLTMQDE
LNAVFHN*
37 >lcl|XP_001500904.1|Plus1complement(24043274..24043858) NW_001867427 putative RNA polymerase II subunit A C-terminal domain phosphatase SSU72-like protein 1-like LOC100053374 __SEG__ Chr7 {Equus caballus} MPSSPLKVAVVCMSNINRSMEAQSILRKKGFSVWSFGAGSQVRLPGDAPNLPVVYNFSTTYKEMYNDLLRKDRQHYIRNGILHILRRNERIKPQPERFQECLEAFDVIFT
CGESIYDRVVEDLCAREQETFQPVHVINVDIQDTLEDATLGALLICELCQRLQHADDVEDSLAKLLLAVEEKRGKSFLHMVFFY*
38 >lcl|XP_001501038.2|Plus165723662..65724963 NW_001867379 uncharacterized protein C2orf53-like LOC100071273 __SEG__ Chr15 {Equus caballus} MLPPNKDQVLLQNAVPPGQPLQSPSQLVDSPPPNLQPLHLQQSLPPSHPPCSPPLWSHSPGSHFYSSDSNSDFALHPYSSSLPRSPAFFHHNYPSLSLPRSSSPSPRLYP
SPTLIHSSSPSQPQNSCLPHSHCQSPSHPEDLPSPSQPSCGVHSNRQTWHWHQYRDTGSPGVVGGCVASERDPAEFRDPGALAQALVVHLGHRRIAHDLRLLLLQRLWLG
RTGQPPVVEYPICLECLRPRGPSCPIPRYGTGPQLLAFPQLLPCAQGQESEPFRMGIGFGLRLPRGQARALHLLPERRREEVGPQGEAAQAHGCQTQASQAPAARAPEAR
TPAAQAQADPARGVPSQTGSLRSAGPQSPNPIPCSGPSPQAPKQAPISLRPRPSSALKRPASLEPIPQKSSPQFQSHGGPLEHLLQTPQSPPGPRPQGTPETP*
39 >lcl|XP_001501052.3|Plus1complement(18388563..18389378) NW_001867381 zinc finger protein 501 ZNF502 __SEG__ Chr16 {Equus caballus} MSSSHISLQVKPQRLHIQKKPSKCSECGKFFTQRSSLIQHQRIHTGEKPYVCSECGTCFRKQSNLTQHLRIHTGEKPYKCNECEKAFQTKAVLVQHLRIHTGEKPYKCNE
CGKAFCQSPSLTKHLRIHTGEKPYKCTECGKAFSQSICLTRHQRSHSGDKPYKCKECGKAFNQSACLMQHQRIHSGEKPYTCTECGKAFTQNSSLVEHERTHTGEKLYKC
SECEKTFRKQAHLSEHYRIHTGEKPYECVECEKSFRHSSALLRHQRLHAGQ*
40 >lcl|XP_001501084.1|Plus18381187..8382272 NW_001877044 POU domain, class 3, transcription factor 4 POU3F4 __SEG__ ChrX {Equus caballus} MATAASNPYSILSSSSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATNPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNH
PNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPASASAQSLHPVLREPPDHGDLGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALG
TLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRR
QKEKRMTPPGDQQPHEVYSHAVKTDTSCHDL*
41 >lcl|XP_001501260.1|Plus121580429..21581577 NW_001867366 neurogenic differentiation factor 2-like LOC100054920 __SEG__ Chr11 {Equus caballus} MLTRLFSEPGLLSDVPKFASWGDGDDDEPRSDKGDAPPPPPPPPGPGAPGPARAAKPVPLRADEVPEAALAEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRK
MTKARLERSKLRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQG
ADGTGRFHGSGGPFAMHPYPYPCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLSPPLCLNGNFSLKQDSSPDHEKSYHYSMHYS
ALPGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPMYEELNAFFHN*
42 >lcl|XP_001501464.1|Plus1complement(13665357..13668047) NW_001867363 zinc finger protein 574 ZNF574 __SEG__ Chr10 {Equus caballus} MTEESEETVLYIEHRYVCSECNQLYGSLEEVLMHQNSHVPQQHFELVGVADPGVTVATEAASGTGLYQTIVQESQYQCLECGQLLMSPSQLLEHQELHLKMMAPQEAVPA
EPPPKAPPLSSSTIHYECVDCKALFASQELWLNHRQTHLRATPTKPQAPVVLGSPVVLGPPVGQARVAVEHSYRKAEEGGEGAVVPSATATTTEVVTEVELLLYKCSECS
QLFQLPADFLEHQATHFPAAAPESEEPALQQETLNPSPAEVPVSQPDPLPSSDHSYELRNGEAIGRDRRGRKARKNNNGEPGGAATQELFCSACDQLFLSPHQLQQHLRS
HREGIFKCPLCSRVFPSPSSLDQHLGDHSSESHFLCVDCGLAFGTEALLLAHRRAHTPNPLHSCPCGKTFVNLTKFLYHRRTHGVGGVPLPTTPVPPEEPVIGFPEPAPA
ETGEPEAPEPPASEESSAGPAAPGTYRCLLCSREFGKALQLTRHQRFVHRLERRHKCGICGKMFKKKSHVRNHLRTHTGERPFPCPDCSKPFNSPANLARHRLTHTGERP
YRCGDCGKAFTQSSTLRQHRLVHAQHFPYRCQECGVRFHRPYRLLMHRYHHTGEYPYKCRECPRSFLLRRLLEVHQLVAHAGRQPHRCSSCGAAFPSSLRLREHRCAAAA
AQAPRRFECGTCGKKVGSAARLQAHEAAHAAAGPGEVLAKEPPAPRAPRATRTPVVSPTTLGGTATAAPAAPARRRGLECSECKKLFSTETSLQVHRRIHTGERPYPCPD
CGKAFRQSTHLKDHRRLHTGERPFACEVCGKAFAISMRLAEHRRIHTGERPYSCPDCGKSYRSFSNLWKHRKTHQQQHQAAVRQQLAEAEAAVGLAVMETAVEALPLVEA
IEIYPLAEAEGVQISG*
43 >lcl|XP_001501630.2|Plus185820494..85822605 NW_001867387 LOW QUALITY PROTEIN: zinc finger protein 770 ZNF770 __SEG__ Chr1 {Equus caballus} MMAENNLKMLKIQQCVVANKLPRNRPYICNICFKHFETPSKLARHYLIHTGQKPFECDVCHKTFRQLVHLERHQLTHNLPFKCSICQRHFKNLKTFVKHQQLHNETYQND
VKQVRRLLEAKQEKPLYGMYHTFSPEERWALHPCSKSDPAYNPTKKRKNIHACTICGKMFPSQSKLDRHALIHTGQRPFKCVLCSKSFRQSTHLKIHQLTHSEERPFQCC
FCQKGFKIQSKLLKHKQIHTRNKTFQTLTLKVKSPESCPLPNKLNAKQDGFENGDIGESEENNQLDVHSIYIVPFQCPECEECFESEQIFNGHKCFPARGGKIPSRLKRS
YNYKTIVKKILAKLKRAGGKKLDNFRSEKKVFKNSLLKNCDLISGEQSPEQTQRTFMGSLGKHGTYKTVGNKKKKTLTLPFSWQKHFQSQNMGKNLKGILSTENVLTMDN
SVNNKDVSVYGSSGEEFYDNCEVLQCGFSLPSENIHAGHKMCPCDKCEKVFPSISKLQRHYLIHTGQRPFGCNVCGKSFRQSAHLKRHKLTHIDKIPYRRSLCQVEFENL
NKLFIHPGDNVNSQQCQPLGFQKYEMSEPDQISEIKVKAESEDFILGTPFRNRQPYLSSALLESEQSHHSHCCSYPGRTERNDGLLYQCSVCSKSFRSPSKLERHYLIHA
GQKPFECSVCGKTFRQAPHWKRHQLTHFKE*PQEKVVVLNSVI*
44 >lcl|XP_001501950.2|Plus1complement(22815471..22816601) NW_001867366 transcription factor Sp6 SP6 __SEG__ Chr11 {Equus caballus} MLTAVCGSLGSQHTDAPHASPPRLDLQPLQTYQGHTSPEPGDYPSPLQPGELQSLPLGPEVDFSQGYELPGASSRVTCEDLESDSPLAPGPFSKLLQPDMSHHYESWFRP
THPGTEDGSWWDLHPGTSWMDLPHTQGALTSPGHPGALQAGLGGYVGDHQLCAPPPHPHPHHLLPAAGGQHLLGPPDGAKALEAAAPESQGLDSSLDGAARPKGSRRSVP
RSSGQTVCRCPNCLEAERLGAPCGPDGGKKKHLHNCHIPGCGKAYAKTSHLKAHLRWHSGDRPFVCNWLFCGKRFTRSDELQRHLQTHTGTKKFPCAVCSRVFMRSDHLA
KHMKTHEGAKEEAAGAAAGDGKAGGAVETPGGKGKREAEGGAAPSN*
45 >lcl|XP_001501955.2|Plus1complement(73615509..73616090) NW_001867379 mesogenin-1-like LOC100072043 __SEG__ Chr15 {Equus caballus} MDNLRETFLSLEDGLGSSDSPGLLSSWNWKDRAGPFELNQASPTQSLSPAPSLESYSSSPCPAVVRLPCGHGDANNGGSDVCSSLGTGGLVEVDYNMLAFQPAYLQGSGG
PKAQKGTKVRMSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTDLLNSGREPRSQSA*
46 >lcl|XP_001501965.1|Plus115851665..15852372 NW_001877044 homeobox protein TGIF2LX-like LOC100072050 __SEG__ ChrX {Equus caballus} MEAGEESPGETDSPAQGASITSNDSSDTGDDLASLAGKRKRKGYFPPEAVKILRDWLYEHRFKVYPSQTEKRMLSEHTGLSLLQISNWFSKDPRRVLLEVLKDAGNDPNQ
ITMYQQKDKTADVTDHPDVDPSMQAKSGPKDPDKMQCLPLRPLPVDQESGEKPLDPELAPDQKLAPEAQPNMKVKFSASRPLVVSSCQPVSAEECKDFSNFQLLVEAALQ
KAAELELQEQQEPNP*
47 >lcl|XP_001502345.1|Plus1complement(27143525..27144850) NW_001867396 zinc finger and BTB domain-containing protein 26 ZBTB26 __SEG__ Chr25 {Equus caballus} MSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDIEVQGHKIVFAAGSPFLRDQFLLNDSREVKISILQSSEVGRQLLLSCYSGVLEFPEMELVNYLTAASFL
QMSHIVERCTQALWKFIKPKQPMDSKEGCEPQSASPQSKEQQGDARGSPKQNSPCIHPSEDSMDMEDSDIQIVKVESIGDVSEVRSKKDQNQFISSEPTALHSSEPQHSL
INSTVENRVSEIEQNHLHNYALSYTGSDNIIMASKDVFGPNIRGVDKGLQWHHQCPKCTRVFRHLENYANHLKMHKLFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKI
CGKTFSQKCSLQDHLNLHSGDKPHKCNYCDMVFAHKPVLRKHLKQLHGKNSFDNANERNVQDLTVDFDSFACTTVTDSKGCQPQPDATQVLDAGKLAQAVLNLRNDSTCV
N*
48 >lcl|XP_001502356.1|Plus1complement(27136728..27138002) NW_001867396 zinc finger and BTB domain-containing protein 6 ZBTB6 __SEG__ Chr25 {Equus caballus} MAAESDVLHFQFEQQGDVVLQKMNLLRQQNLFCDVSIYINDTEFQGHKVILAACSTFMRDQFLLTQSKHVRITILQSAEVGRKLLLSCYTGALEVKRKELLKYLTAASYL
QMVHIVEKCTEALSNYLEIDLSMKNSNQHNDLCQSSDPDVKNEEENSDKDCEIIEIPEDSPVNIDFHVKEEESNVLQSTVENLTSERKEMKSPELSSVDIGFKDNEICIL
HVESISTAGVENGQFSQPCTSSKASMYFSETQHSLINSTVESGVAEVPGNQDQGLFCENTERSPGTVNEIQNLEDAYSLRHQCPRCPRGFLHVENYLRHLKMHKLFLCLQ
CGKTFTQKKNLNRHIRGHMGIRPFQCTVCLKTFTAKSTLQDHLNIHSGDRPYKCHCCDMDFKHKSALKKHLTSVHGRSSGEKLPRHDLKRQNLL*
49 >lcl|XP_001504859.1|Plus115041722..15043029 NW_001867424 zinc finger CCCH domain-containing protein 10 ZC3H10 __SEG__ Chr6 {Equus caballus} MPDRDSYANGTGSSSGGPGGGGSEEASGTGAGSGGASSDAICRDFLRNVCKRGKRCRYRHPDMSEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGE
LPPRLRQKVAAGLGLSPADLPNGKEEVPICRDFLKGDCQRGAKCKFRHLQRDFEFDARGGGGTGGGGSTGPVPPGRRHDLYDIYDLPDRGFEDHEPGPKRRRGGCCPPDG
PHFESYEYSLAPPRGVECRLLEEENAMLRKRVEELKKQVSNLLATNEVLLEQNAQFRNQAKVMTLSSTAPATEQTLAPTVGTVATFNHGIAQTHTTLSSQALQPRPVSQQ
ELVAPAGAPAAPPTNAAPPAAPPPPPPHLNPEITPLSAALAQTIAQGMAPPPVSMAPVAVSVAPVAPVAVSMAQPLAGITMSHTTTPMVTYPIASQSMRITAMPH*
50 >lcl|XP_001504958.1|Plus1complement(30129487..30130032) NW_001867427 achaete-scute homolog 3-like LOC100071044 __SEG__ Chr7 {Equus caballus} MMDNRSYSNLPDKLPVFADSAHLPLARSFYLDPTVTFHLYPEAPVPSPSSEELPLLPFSSDSVIMENYGEPCPFSFPMTYPNYRRFEYSYGPAFIRKRNERERQRVKCVN
EGYAQLRHHLPEEYLEKRLSKVETLRAAIKYINYLQSLLHPDKTETKNNPGTCSSIMATASLHADPIFRII*
51 >lcl|XP_001505088.1|Plus125624133..25625209 NW_001867389 zinc finger protein 391 ZNF391 __SEG__ Chr20 {Equus caballus} MESLRGNTAQGPTNEEGCKSEDQLSRQTKCNVQKKSSFEKRTIRKVSMTLKEIFTRERGPESSEFSLTSKLHTQQKIPKGTRSLISRKNSKVNSNLIKHQKLFSQKKLCK
CNECGKAFSYQSNLIVHSRIHDGEKPFECNECGKTFSRSTHLIEHQRTHTGEKPYECSECGKAFSRSTHLSLHQRIHTGEKPYECRECGKAFSRSTNLSQHQRTHTQEKP
YKCNDCGKAFSDRSTIIQHQRIHTGENPYECSECGKAFSWISSLIEHQRIHTGENPYECSDCGKVFSRSSSLIEHQRIHTGEKPHECRECGKGFSRSSSLIIHQRTHTGE
KPYKCNDCGKAFSQSSTLIRHQQLHSKE*
52 >lcl|XP_001505094.1|Plus1complement(24876394..24877602) NW_001867389 zinc finger protein 322A ZNF322A __SEG__ Chr20 {Equus caballus} MYTSEERYNQRTQKRKIYHVCPQKGKTIFIRVHEITQIDDQIYQCLEREQNLCENLALIMCERTHTGEKPYRCDMCEKTFIQSSDLISHQRIHNYEKPYKCSKCEKSFWH
HLALSGHQRTHAGKKFYTCDICGKNFGQSSDLLVHQRSHTGEKPYLCSECDKCFSRSTNLIRHRRTHTGEKPFKCLECEKAFSGKSDLISHQRTHTGERPYKCNKCEKSY
RHRSAFIVHKRVHTGEKPYKCGACEKCFGQKSDLIVHQRVHTGEKPYKCLECMRSFTRSANLIRHQATHTHTFKCLEYEKSFNCSSDLIVHQRIHMEEKPHQWSTCESGF
LLGMDFVAQQKMRTQTEELHYKYSVCDKSFHQSSALLQHQTIHIGEKPYICNMGEKGLELSPPHASEASQMS*
53 >lcl|XP_001914692.1|Plus1complement(9764..10684) NW_001867365 zinc finger protein 79-like LOC100056277 __SEG__ Chr11 {Equus caballus} MLDPFGKSVKWNLSPSRRQRNPKKKTYNCSECGRSFSDSSNFIHHQRIHTGEKPYKCDDCGKAFSQSSSLTEHQRTHTGERPYKCKVSGKAFTVKSSLIQHQRIHTEEKP
YKCNECGEAFSDYSSFIQHRRIHSGEKPYECSDCRKSFTDIPSLTQHQRIHTGVKPYKCNDCGKAFRRSTHLTQDQRTHTGEKPYKCHECGKAFTAHSTFTQHQRIHTGG
KPYMCSECGKDFPENSSLTKHQRIHTGEKPYECNQCGKSFSQSTHLIQHQRIRAGEKPFKCSGCGKAYSNSLVLIRHQQLHTLKSY*
54 >lcl|XP_001914790.1|Plus1complement(2628627..>2629994) NW_001877041 zinc finger X-linked protein ZXDB ZXDB __SEG__ ChrX {Equus caballus} YNLKAHMKGHEQENSFKCEVCEESFPTQAKLSAHQRSHFEPERPYQCAFSGCKKTFITVSALFSHNRAHFREQELFSCSFPGCSKQYDKACRLKIHLRSHTGERPFLCDF
DGCGWNFTSMSKLLRHKRKHDDDRRFTCPVEGCGKSFTRAEHLKGHSITHLGTKPFVCPVEGCCARFSARSSLYIHSKKHLQDVDTWKSRCPVSTCNKLFTSKHSMKTHM
AKRHNLGQDLLAQLEAANSLTPSSELASQGQSDLSDAELVSLFSDVPGSSSAAVLDTALVNSGILTIDVASVSSTLAGNLPAANNSSLGQALDPRGLMATGDLPQSLDTS
LFFGTTAAGFQQSPLGMDDVSSLSAGPLGSLGSLAMKNSSQEPQALTPSSKLTVDSDALTPSSTLCENSVSDLLTPTKAEWNIHPDSDFFGQEEETQFGFSNPAGAHGSQ
KETDLTTVTGSSFLV*
55 >lcl|XP_001915659.1|Plus120744600..20745172 NW_001867389 hepatoma-derived growth factor-like LOC100147396 __SEG__ Chr20 {Equus caballus} MFFFGTHETAFLSPQRLFPYEEAKEKFGRPNKRRGFSAGLWEIENNPTVQVAGQPLAQEQSCAEGPPPASEATEGDGDQESIADGDSDEQGKPGVDQTVQEAGEKGPLKR
SAGELPEDAAKRPKEAAPEAEEEEAAGEAALLLEPEEEDASATAQPGLAGGSPPEQREPKEEAAEKDVEAPGVGEGRESL*
56 >lcl|XP_001916007.2|Plus1complement(7967367..7968215) NW_001867419 hypothetical protein LOC100061103 LOC100061103 __SEG__ Chr5 {Equus caballus} MSQQHILPVTLPPALSQEPLKPVSPPTHIQQEQVKQPTPLPAPCQVASELRGEVPLENGEKHTPLVKGVPEQECEPQQQEQHLEEQQQQESQEQKLHLGQPQQQESQEQK
LPLGQHVEQQQEQEEPQEQEAQKQQQEQHEEHHKAENLDLQLEQEKAQREKQLQEQLEQEKKLLDQQLDQELAKRDGQQEKKEEQLLEHLEKKEEQLLEHLEKKEEQLLE
HLQKKEEQLLEHLEKKEGSAEQQEGQPEQPAFVPAPGQVQETQPVQPLKGEVLLPAKQQQQH*
57 >lcl|XP_001916935.1|Plus1complement(4197530..4198111) NW_001867427 methyl-CpG-binding domain protein 3-like 1-like LOC100063717 __SEG__ Chr7 {Equus caballus} MVKSSQRNQSKPKPGLSTSIPLRLSSYIFQRSVTSHPGNEVRCHQWEETLERPQQVCWQKRLQGLQACSSAGELLSPLDLAKALHNLTPNCTGTSLPGVLRGGLNSSPMP
APFRSLDFAEMIPRAGLDIPQQLCKQFLVTEEDIRKQEGKVKMARERLTMTLVADRLASEAERVRGQEGHPDKHYEKKRRWRR*
58 >lcl|XP_001916939.1|Plus1complement(4248466..4249074) NW_001867427 methyl-CpG-binding domain protein 3-like 1-like LOC100063843 __SEG__ Chr7 {Equus caballus} MVKSAQRKQHDCGNQSKPKPGLSTSIPLRLSSYIFQRPVTRITSHPGNEVRCHQWEETLERPQQVCWQKRLQGLQACSSAGELLSPLDLAKALHNLTPSCTGASLPGVLT
GGLNSSPMPTPSGSSDFAEMIPGAGMGVPQLLCKQFLVTEEDIRKQEGKVKMARERLAMALIADRLAGEAEKVRAQDGRPDKHYEKNRRWCR*
59 >lcl|XP_001917872.2|Plus124709814..24710599 NW_001867363 zinc finger protein 524-like LOC100146199 __SEG__ Chr10 {Equus caballus} MDSPSPDPLPSPLPGEEEKPLALPPPVPRGRRGRRPGGPTSSNRTLKASLPRKRGRPPKSGQEPPLAQGVTAPVGSGGGSDLLLIDDQGVPYTVSEGSAAGGPEGSGPKK
APHFCPVCLRAFPYLSDLERHSISHSELKPHECKDCGKTFKRSSHLRRHCNIHAGLRPFRCPLCPRRFREAGELAHHHRVHSGERPYQCPVCRLRFTEANTLRRHAKRKH
PEAMGAPLCPPDPGPQPPWDDEGIPATAGADEEELEGKELA*
60 >lcl|XP_001917880.1|Plus1<24743594..24743959 NW_001867363 zinc finger protein 580-like LOC100146612 __SEG__ Chr10 {Equus caballus} RHLLIDANGVPYTYTVQLEEEPRGPPQRETPPGDPSPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGACGKAFKRSSHLSRHRATHRARAGPPHTCPLCPRRFQD
AAELAQHVRLH*
61 >lcl|XP_001918142.1|Plus1complement(11537497..11538627) NW_001867420 protein arginine N-methyltransferase 6-like LOC100060260 __SEG__ Chr5 {Equus caballus} MSQPKKRKLESGGGGGGGGEGTEEEDGGEREAAVPRPRRTRRERDRLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVY
AVEASAIWQQAREVVRLNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFVAPISDQMLELRLDFWSQVKQLYDVDM
SCLESFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELARAGLEQELEAGVGGRFRFSCYGSAPMHGFAIWFQVTFPGGDSEKPLVLSTSPFHPVTHWKQALLYLNEPV
QVEQDTAISGEITLLPSRDNHRLLRVLLRYKVGDQEEKTKDFAMED*
62 >lcl|XP_001918286.1|Plus124745571..24746167 NW_001867363 zinc finger protein 581-like LOC100146606 __SEG__ Chr10 {Equus caballus} MLVLPSPCPHPLALLSAEAMEAPPPRTGRSPEPGPSSSTGSPQTSSPPRPNHYLLIDTQGVPYTVLVDEDEAHREPGANGASAQKKCYSCPVCSRVFEYMSYLQRHSITH
SEVKPFECDTCGKAFKRASHLARHHSIHRAGGGRPHGCQLCPRRFREAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP*
63 >lcl|XP_001918387.1|Plus192709752..92710549 NW_001867377 transcription initiation factor TFIID subunit 9-like LOC100073308 __SEG__ Chr14 {Equus caballus} MESGKMASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPY
SGPRLPPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTVSVSTKVGTPVSLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIG
SKNILITTNMVSSQNTASESSNTSKRKREDDDDDDDDDDDDYDNL*
64 >lcl|XP_003362312.1|Plus17660657..7661895 NW_001867363 zinc finger protein 260-like LOC100630327 __SEG__ Chr10 {Equus caballus} MIKMLESLQPESDLLQHDQIHAREKPFECKECGKMFSLKQNLIEHKKMHTGEKSHECTECGKVFSRVSSLTLHLRSHTEKKPYKCNKCGKAFSQKGNFLSHQKHHIGEKP
YECGKASIQIPSLIKHQRNHTGNKPYACKECGKAFNGKSYLTEHEKIHTGEKPFECNQCGRAFSQKQYLIKHQNIHSGKKPFKCNECGKAFSQKENLIIHQRIHTGEKPY
ECKGCGKAFIQKSSLIRHQRSHTGEKPYICKECGKAFSGKSNLTEHEKIHIGEKPYKCNECGTIFRQKQYLIKHHNIHTGEKPYECNKCGKAFSRITSLIVHVRIHTGDK
PYECKICGKAFCQSSSLTVHMRSHTGEKPYGCNECGKAFSQFSTLALHMRIHTGEKPYQCSECGKAFSQKSHHIRHQRIHTH*
65 >lcl|XP_003362373.1|Plus14516037..4516489 NW_001867363 CCAAT/enhancer-binding protein gamma-like LOC100630820 __SEG__ Chr10 {Equus caballus} MSKIAQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVPPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKL
LTKELSVLKDLFLEHAHNLTDNVQPSSTENLTTNSDNAGQ*
66 >lcl|XP_003362463.1|Plus134584033..34584161 NW_001867366 zinc finger HIT domain-containing protein 3-like LOC100629929 __SEG__ Chr11 {Equus caballus} MVSLDQGDNKAKLMRACMQEPLFVEFADCCLRIVEPSQNEDS*
67 >lcl|XP_003362732.1|Plus1complement(1182190..1182753) NW_001867371 class A basic helix-loop-helix protein 15-like LOC100062732 __SEG__ Chr13 {Equus caballus} MKTKTRPPRRRAQPQDTEATPGERTQDRPQPGSGPELIKGLRSRTARAQGARAEGGRRRPGSSGPGGRRESSVQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKL
SKIETLTLAKNYIKSLTATILTMSSGRLPGLDGPGPKLYQHYQQQQAAGGALGATEAQPEGHLQKYSTQIHSFREGS*
68 >lcl|XP_003362825.1|Plus119567291..19568658 NW_001867377 PWWP domain-containing protein 2A-like LOC100629628 __SEG__ Chr14 {Equus caballus} MYREEPTSIMNAIKLRPRQVLCDKCKNSVVAEKKEIRKGSSASDSSKYEDKKRRNESVTTVNKKLKTDHKVDGKNQNESQKRNAVVKVSNIAHSRGRVVKVSAQANTSKA
QLSTKKVLQSKNMDHAKAREVLKIAKEKAQKKQSETSTSKNAHSKVHFTRRYQNSSSGSLPPRVRLKPQRYRNEENDSSLKTGLEKMRSGKMAPKPQSRCTSTRSAGEAP
SENQSPSDGPEEASCEVQDTNEVLVPGEQEEPQTLGKKGSKSNISVYMTLNQKKSDSSSASVCSIDSTDDLKSSNSECSSSESFDFPPGSRHAPSTSSTSSSSKEEKKLS
NSLKMKVFSKNVSKCVTPDGRTICVGDIVWAKIYGFPWWPARILTITVSRKDNGLLVRQEARISWFGSPTTSFLALSQLSPFLENFQSRFNKKRKGLYRKAITEAAKAAK
QLTPEVRALLTQFET*
69 >lcl|XP_003362828.1|Plus122041512..22042213 NW_001867377 mediator of RNA polymerase II transcription subunit 7-like LOC100629872 __SEG__ Chr14 {Equus caballus} MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLE
DLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQSCLASLPDDLPRSEGGIRVKTEPMDADDSNNCSGQNERQRENSGHRRDQIIEKDA
ALCVLIDEMNERP*
70 >lcl|XP_003363179.1|Plus1complement(18507316..18508305) NW_001867381 zinc finger protein 660-like LOC100630913 __SEG__ Chr16 {Equus caballus} MRRKMRNFKHKTLNKTLIEVSDQESEKDGSQFSDPATDEKFQAEKRQYVCTECGKAFSQSANLTVHERIHTGEKPYKCKECGKAFSHSSNLVVHRRIHTGLKPYTCSECG
KSFSGKSHLIRHQGVHSGEKTYECKECGKAFSRSSGLISHHRVHTGEKPYTCIECGKAFSRSSNLTQHQKMHKGKKVYKCKECGKTCVSNTKIMDHQRIHTGEKPYECDE
CGKAFILRKTLNEHQRLHRREKPYKCNECGKAFTSNRNLIDHQRVHTGEKPYKCNECGKTFRQTSQVILHLRTHTKEKPYKCSECGKAYRYSSQLIQHQRKHNEEKETS*
71 >lcl|XP_003363214.1|Plus149247907..49248629 NW_001867381 transcription factor SOX-14-like LOC100066630 __SEG__ Chr16 {Equus caballus} MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGL
PVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSASTLQPPVAYIL
FPGMTKTGIDPYSSAHATAM*
72 >lcl|XP_003363254.1|Plus116527502..16527834 NW_001867383 prothymosin alpha-like LOC100051754 __SEG__ Chr17 {Equus caballus} MSDAAVDTSSEITTKDLKEKKEVVEEEENGRDAPANGNSNEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAATGKRAAEDDEDDDVDTKKQKTDEDD
*
73 >lcl|XP_003363363.1|Plus110430319..10430558 NW_001867385 DNA-directed RNA polymerases I, II, and III subunit RPABC5-like LOC100629865 __SEG__ Chr19 {Equus caballus} MIGQPVELASTAIIILVRCFTCGTIICNKLEACLGLLQAQYIKGAALDALGPKCICSHCMLLAHVHLTEWLLNYAPLEK*
74 >lcl|XP_003363716.1|Plus1complement(64751933..64752910) NW_001867387 forkhead box protein B1-like LOC100067939 __SEG__ Chr1 {Equus caballus} MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFK
VLKSDHLAPSKPADAAQYLQQQAKLRLSALAASGTHLPQMPAAAYNLGGVAQPSGFKHPFAIENIIAREYKMPGGLAFSAMQPVPAAYPLPNQLTTMGSSLGTGWPHVYG
SAGMIDSATPISMASGDYSAYGVPLKPLCHAAGQTLPAIPVPIKPTPAAVPALPALPAPIPTLLSNSPPSLSPTSSQTATSQSSPATPSETLTSPASALHSVAVH*
75 >lcl|XP_003363797.1|Plus126633600..26634424 NW_001867389 zinc finger protein 271-like LOC100629159 __SEG__ Chr20 {Equus caballus} MDPHQKVPSIYNGDTLGEINGEIPEYEKVPLYEDQLERHEDGPTEERRYKCSDCGKKFAQSSGLVRHRRIHTGEKPYECDHCGKAFSVRSTLTVHERIHTGEKPYTCNEC
RKAFSVRAHLIIHQRIHNGEKPYECIECGKAFSVSSDLIKHQRIHSGERPYECNECGKAFSVSSALIKHQRIHTGEKPYECKECGKAFYVNSALINHQRIHSGERPYECG
QCRKAFSQISTLIHHQRIHTGEKPYECDECGKAFRGSSNLAKHQKIHTKGKCQK*
76 >lcl|XP_003364241.1|Plus127629878..27630081 NW_001867397 hypothetical protein LOC100630435 LOC100630435 __SEG__ Chr26 {Equus caballus} MCGYYRNYYGGRGYGCCGYGGLGSGYGSCYGCGFRRLGCGYGYGYPSLYGCGYGCGFGYGSGFGYYY*
77 >lcl|XP_003364540.1|Plus1complement(2772495..2773496) NW_001867404 early growth response protein 3 isoform 3 EGR3 __SEG__ Chr2 {Equus caballus} MDIGLTNEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAMYPALPPYSNCSDLYSEPVSFHDPQ
GNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERP
HACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVT
TCA*
78 >lcl|XP_003364600.1|Plus1complement(978770..980338) NW_001867406 zinc finger protein 238 isoform 2 ZNF238 __SEG__ Chr30 {Equus caballus} MEFPDHSRHLLQCLREQRHQGFLCDCTVLVGDAQFRAHRAVLASCSMYFHLFYKDQLDKRDIVHLNSDIVTAPAFALLLEFMYEGKLQFKDLPIEDVLAAASYLHMYDIV
KVCKKKLKEKATTEADSTKKEEDASSCSDKVESLSDGSSHMAGDLPSDEDEGDDEKLNILPSKRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTE
SLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQVKVEKEASCDESDVGTNDYDMEHSTVKESVSTNNRVQYEPAHLAPLREDSVLRELERED
KASDDEMMTPENERVQVEGSMESSLLPYVSNILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGLRSKPAADVNVPTCSLCGKTFSCMYTLKRHERTHSGEKPYTC
TQCGKSFQYSHNLSRHAVVHTREKPHACKWCERRFTQSGDLYRHIRKFHCELVNSLSVKSEALSLPAVRDWTLEDSSQELWK*
79 >lcl|XP_003364676.1|Plus120207638..20207970 NW_001867410 prothymosin alpha-like LOC100054201 __SEG__ Chr3 {Equus caballus} MSDMAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAKEENGEQEADNELYYDEEEGGEEEEEEEEGDGEEEDGDEDEEAEAATGQRLAEDDEDSDVDTKKQKTDEDD
*
80 >lcl|XP_003365291.1|Plus1complement(11535692..11536933) NW_001867424 transcription factor Sp7 isoform 2 SP7 __SEG__ Chr6 {Equus caballus} MLTAACSKFGGSSPLRDSTTLGKAGTKKPYSVGSDLSAPKTMGDAYPAPFSSTNGLLSPAGSPPAPTSGYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTS
LDMAHPYGSWYKAGIHAGISPGPGNAPTPWWDMHPGGNWLGGGQGQGDGLQGTLPTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSG
QLEGSGGAKPPRGAGTGGSGGYGGSGAGRSSCDCPNCQELERLGAAAAGLRKKPIHSCHIPGCGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTH
TREKKFTCLLCSKRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSAGEEEASQTPRPSASPAPPEKAPGGSPEQSNLLEI*
81 >lcl|XP_003365638.1|Plus127415811..27417064 NW_001867432 zinc finger protein PLAG1 isoform 3 PLAG1 __SEG__ Chr9 {Equus caballus} MATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKETFKCEECGKNYNTKLGFKRHLALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSSGGVKEKKHQCEHCDR
RFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQELLKVKTEPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQSSG
SAHQMITTLPLGMTCPIDMDAVHPSHHLSFKYPFSSTSYAISIPEKEQPLKGEIESYLMELQGGVPSSSQDSQASSSKLGLDPQIGSLDDGGGDLSLSKSSISISDPLNT
PALDFSQLFNFIPLNGPPYNPISVGSLGMSYSQEEAHSSVSQLPPQTQDLQDPANTLGLGSLHSLSAAFTSSLSTSTTLPRFHQAFQ*
82 >lcl|XP_003365653.1|Plus16322459..6322779 NW_001867433 hypothetical protein LOC100630345 LOC100630345 __SEG__ Chr9 {Equus caballus} MQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGPRTAGNVRPGQERLTNDRYLRPDGPERSAPCRMPRGPPGVGYSFFGTYERKEASAWTYHP*
83 >lcl|XP_003365867.1|Plus118441288..18441728 NW_001877044 DNA polymerase epsilon subunit 3-like LOC100630012 __SEG__ ChrX {Equus caballus} MTESPEDLNFPNAVVTRIIKEALLDGVNISKEARSAISRAASVFMLSATYWANNFAMKGKRKPLNASDVLSAMEEMEFQRFITLLKEALEAYKREKKGKKEASEQKKRDK
GKKTDSEEPDKSRDEDTDEDEERLEEEQNEDEEVDN*