SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr I    

ID / Description / Sequence
1 >lcl|NP_001161126.1|Plus1complement(182381..183274) NW_003535609 phosphatidylinositol N-acetylglucosaminyltransferase subunit C PIGC __SEG__ Chr9 {Sus scrofa} MCSQPVTNTKEAKWQKVLYERQPFPDNYVDRRFLEELRKNIYARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPHWLFGTGLASSLIGYVLFDLIDGGEGRK
KSGRTRWADLKSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKL
KACTPCSYVGVTLLFAFSALGGLLSISVVGAILFALLLVSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS*
2 >lcl|XP_001928655.2|Plus1complement(892448..893383) NW_003536280 cholesterol 25-hydroxylase-like LOC100157868 __SEG__ Chr14 {Sus scrofa} MQALRSREREKRLLTSHGAGPKALRKVRRTRAAAAARHNLTMSGHNNSELLVLCSSGQLFLQPLWDHLKTWETLIQSPFFPVFFSITTYLGFCLPFVVLDVLCPWVPALR
RYKIHPDFSPSVWQLLPCLGLTLYQHVVFVFPMTLLHWAASPVLLPPEAPELLQLVRHIVLCLLLFDTEFFIWHVLHHKVPWLYRTFHKMHHQNSSSFALATQYMSVGEL
LSLGVFDMVNIMLLRCHPLTVLIFHVINIWLSVEDHSGYDFPWSTHRLVPFGWYGGVTHHDLHHSQFNCNFAPYFTHWDKILGTLRSAHAK*
3 >lcl|XP_001928954.1|Plus1complement(882270..883886) NW_003534175 dolichol kinase-like LOC100152320 __SEG__ Chr1 {Sus scrofa} MTRECAPPASGSGAPLSGSVLAEAAVVFIVVLSIHAAVWDRYSWCAVALAVQAFYVQYKWDRLLQQGSAVFQFRMSANSGLLPASVVMPLLGLVMKERCQAAGNPYFERF
GIVVAATGMAVALFSSVLALGITRPVPTNTCVISGLAGGVIIYIMKHSLSVGEVIEVLEVLLIFVYLNMILLYLLPRCFTPGEALLVLGGISFMLNQLIKRSLTVVESQG
DPLDFFLLVVVVGMVLMGIFFSTLFVFMDSGTWASSIFFHLMTCVLGLGVVLPWLHRLIRRNPLLWLFQFLFQTETRVYLLAYWSLLATLACLVVLYQNAKRSSSESKKH
QAPTIARKYFHFIVVATYIPGIIFDRPLLYVAATVCLAVFIFLEYVRYFRIKPLGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVP
YAGVLAVGVGDTVASIFGSTMGEIRWPGTKKTFEGTMTSIFAQIISVALILIFDSGVDLNYSYAWILGSISTVSLLEAYTTQIDNLLLPLYLLILLMA*
4 >lcl|XP_003126965.2|Plus1complement(906..1217) NW_003534908 group XV phospholipase A2-like LOC100519365 __SEG__ Chr6 {Sus scrofa} MRQDTEGLVDAMVPPGVQLHCLYGTGVPTPDSFYYESFPDHDPRICFGDGDGTVNLESALQCQAWRGRQEQEVSLQALPGSEHIAMLANATTLAYLKRVLLGP*
5 >lcl|XP_003131864.1|Plus1complement(84557..84820) NW_003300956 diazepam-binding inhibitor-like 5-like LOC100523863 __SEG__ Chr12 {Sus scrofa} MCQVEFEMACAAIKQLKGPVSDKEKLLVYSFYKQATQGDCNIPAPSATDVKAKAKWEAWNGNKGMSKMDAMRLYVAKVEELKKNEAG*
6 >lcl|XP_003359943.1|Plus168850..69251 NW_003536624 fatty acid-binding protein, heart-like LOC100627705 __SEG__ Chr17 {Sus scrofa} MADTFMGIWKLVDSKNFDDCMKSIGVGFATRQVANMTKPTTVIEVNGDTITIKTQSTFKSAEISFKLGLKFDETTADDRKVKSIVTLDGSKLVHVQKWNGQETTLVRELV
DGKLILTLTHGSAVCTCIYEKEA*