SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor I    

ID / Description / Sequence
1 >lcl|NP_001012207.1|Plus18704249..8705142 NW_047398 phosphatidylinositol glycan anchor biosynthesis, class C Pigc __SEG__ Chr13 {Rattus norvegicus} MCAQHVADTSEVKWQKVLYERQPFPDNYVDQRFLEELRKNIYARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPQWLFGTGLASSLVGYVLFDLIDGGDGRK
KSGRTRWADLKSTLVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKL
KAYTPRSYVGVTLLFAFSAFGGLLSISGVGAILFALLLFSISCLCPYYLIHLQLFKENIHGPWDEAEIKEDLSRFLS*
2 >lcl|NP_001020586.1|Plus1complement(6640519..6641415) NW_047565 cholesterol 25-hydroxylase Ch25h __SEG__ Chr1 {Rattus norvegicus} MACHNVSELQDLGCSNQLLLQPLWDSIRTGEASARSPFFPVIFSIFTYLGFCLPFVVLDVLCPWVPILRRYKIHPDFSPSVRQLLPCLGLTLYQHLVFVFPVTLMHWARS
PALLPREAPELSQLLSHVLICLLLFDTEIFAWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELLSLTFFDVLNVAMLQCHPLTILVFHVVNIWLSVEDHSGYDF
PWSTHRLVPFGWYGGVAHHDLHHSQFNCNFAPYFTHWDKMLGTLRCAPHSKRLCAGSESCLDSGEQCTVHLNQKKKQT*
3 >lcl|NP_001020802.1|Plus1complement(2550092..2551648) NW_047419 acyltransferase like 1B Aytl1b __SEG__ Chr14 {Rattus norvegicus} MAHQTQRRDTADTMTEVEVWDSRTAQEVNKSL*YPPAVTNPFTHHTQLSAWQLACSIFLGTVLVPVRVSCIVFLFLLLWPVALLSTINLPIQPTEPVKSWRKHLIKPVFI
FLLRLAFFCAGFLIKVKGKKATREEAPIFVVAPHSTFFDAIAVIVAGLPSVVSDTQHVRIPLVGQCILLTQPVLVRREDPNSRKTTRNEILSRVKSKMKWPQILIFPEGL
CTNRSCLVTFKLGAFSPGVPVQPVLLRYPNTLDTVTWTWHGFSGFQVCMLTLSQPFTRMEVEFMPVYIPNEDEKKDPILFANTVRINMANALKLPVTDHSFEDCKLMISA
GALRLPMEAGLVEFTKISQKLKLDWDNIHTHLDKYASVAVSSKGGKIGIEEFSRYLKLPISEPLRQLFSLFDRNQDGTIDFREYVIGLTVLCNPANTEKILQMSFKLFDL
DEDGYITEQELTTMLRAAFGVPDLDVSTLFQQMAGKDSAQVSYRTFRRFALKHPAYAKLFHSYIDLQAAYIYSLPGEV*
4 >lcl|NP_001020868.1|Plus1complement(12917671..>12917787) NW_047798 hydroxysteroid dehydrogenase like 2 Hsdl2 __SEG__ Chr8 {Rattus norvegicus} *GK*KPAMAFMSGKLKI*GNIALAIKLEKLMTHMNSRL*
5 >lcl|NP_001036084.1|Plus1complement(1633210..1634022) NW_047627 3 beta-hydroxysteroid dehydrogenase/delta-5-delta-4 isomerase type II Hsd3b __SEG__ Chr2 {Rattus norvegicus} GTQNLLEAGIHASVPAFIYCSTVDVAGPNSYKKTILNGREEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGTLHTCALRPMYIYGERGQFLSRIIIMALKNKGVLN
VTGKFSIVNPVYVGNVAWAHILAARGLRDPKKSQNIQGQFYYISDDTPHQSYDDLNCTLSKEWGLRLDSSWSLPLPLLYWLAFLLETVSFLLRPFYNYRPPFNCHLVTLS
NSKFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ*
6 >lcl|NP_001100436.1|Plus1complement(25066344..25067654) NW_048043 hypothetical protein LOC302772 RGD1562485 __SEG__ ChrX {Rattus norvegicus} KEYGGVFVTFSYAGKQSTKVTIKGAKACVEAAKKHIQGIFDPLGSQVTAQCVVPPKFHPFIMGPICSRIQQTARECKVQIKFPDTEKTTKKTHPEVQEMEKDKGGKNVRK
PASTSPKKSDTTSTSGKTENCKEAAQALETLVPVTAEVQVPFHLHPYIIGHRGSGLRKLIKDFEVHIQVSQPGGNFHIISIMGLEANVEQAKTKLQNQVKALQMELDDQT
LRSFRQTFRLDSKYHSKIFGNKGILISQICTEYDVTVHFSKKGSNSTQDQITISGSKSNILGARDAIMNMLRKIEKTVSREIPLNHHVCANIIGFGGKSIQKIMEQYHVD
IRVPPKGSHTNSTIIVSGSSANVQEAIDYILSLEKHFLSVGKSDPPSDHHKRGGVCNTAARTYKSFGKRNTLRNVKSTTHPPHLDNAEDFPKLKQQTPPKFHPWRP*
7 >lcl|NP_001100437.1|Plus125148168..25151920 NW_048043 hypothetical protein LOC302773 RGD1563104 __SEG__ ChrX {Rattus norvegicus} MNSKRNSASYQNMSVQKENHYKSSNDVVHMSRYNKEVTEHPKKINFSENPEETAESSSINIFKAGEISTLTQVFHVLLEKENYLTQFGEGTLAKFYAHIMENTGVNLESS
FIKDQGLYVTVFGNSEAVTNAENEILKWCQEKYLPLTLISKQEHCFFLDQTGDKSQDTEQEAEINAQIISPHNHSHYINTVDTNLTKMKSSDGSLSTSDRNSKSDIQILE
MEKAFNPRIGKPYLQASDIFQETEEHVPFQLSSANETDVDINERQLNVDQTRCHKNDMTEKSSTITEGMMMKFQGNYTRSLKRNFLEEILETSEDSTGQSPSESISDSMT
QHSEPDSSGEIFNEVHGNDDDYIVSSIFAPSWLHRFIIGKKGEKIAEISECVPKVQIHFTAKDKITLKGPIDDVNYAQEKFDIIVKDLISRMEYTEINGDSKFHKYLTGN
NGAILNKIAERNQVSITMVPENELNHTIRIEGESLGVQQAKKELLDLANNLEEEYSQDIIIKHQFHHILIGQKGERVREICKKFPDVILNFPHPAEKSDIVQLIGPRYES
EKCAQYLENMLTDIKENNYSISISIIKKLHKRLIGKGASNIKKISETTNTKISFPPENCNSEEFIITGYPENCEIARNWILSIQQEIADTAEEEITIPTNLYKYLNNPKE
CLLNSIIEECGKIHLHFPKNKSSLNKVIIMGSVESVEKAKAKLLKLAEEEQAKNYSEKIRVKSQYHQFLVNKNGGNISQICDETGTCVLFPNHTNKDQESLTITGSEESV
KEVQKRLEDLVKDFENEVDDSILINRRFHHYFVMRRGQLLKEMTEEYGGVVITFSYAGRQNTKVTIKGAKPCVEAAKKHIKAIFEPLGSQVTTRYVIPQNFQPFIMGPIT
SRIQQIARDYKVEIKFPDIEKPAINMDLATQEKGKEKWKKPAKDLAPNSPRKSDTIFISGQVENCKAATEALASIIPVTAEVHVPLHLHPYIIGHKGSGLRKLVKEFEVH
MQPPQPGKNSDIISIMGLAANVEQAKMKLQKRVKALQMEIEDRTLRNFKLMFNLDSKYRAKITGHKGLLITQICTEHDVTVRFPKKGSHEVQDQITITGYKENTLAARDA
IMRVLHKIEKTISKEITLNQQVRSNVFGFRGKTINKIMDQYQVDIRSPPKGSYNPNITVTGLPDNVEKAIEHILNLEKYYLSAAANHESQQEEAKSMSLCNIAMTPSKSF
VRKYVPCYAKTTTKLPDVDNCEHFPRLKQRISSKTHPSKL*
8 >lcl|NP_001101255.1|Plus123551573..23552043 NW_047658 hypothetical protein LOC311491 RGD1308385 __SEG__ Chr3 {Rattus norvegicus} MWKRTDPQAKIKAGDRPQTCHSLALGSATESALPHPLELSDFQSFSVFEDISHHIKEGGAQLVKKVNAIFQLDITKDGKTILQWTIDLKNGSGDMYLGSARLPADTIFII
PDTVFTELVVGKMNPQKAFLAGKFKVRGKVLLSQKLERIFREWAKF*
9 >lcl|NP_001101296.1|Plus1complement(9329808..9331418) NW_047651 dolichol kinase Dolk __SEG__ Chr3 {Rattus norvegicus} MTRQCPPQAPESGFALSGSVLAEAAVVFAVVLSIHAAVWDRYSWCAVALAVQAFYVQYKWDRLLQQGNAVFQFRMSANSGLLPASMVMPLLGLVMKERCLTAGNPYFERF
GIVVAATGMAVALFSSVLALGITRPVPTNTCAISGLAGGIIIYIMKHSLSVGEVIEVLEVLLIFVYLNMILLYLLPRCFTPGEALLVLGGISFVLNQLIKRSLTESQGDP
VDFFLLVVVVGMVLMGVFFSTLFVFMDSGTWASSIFFHLMTCVLGLGVVLPWLHWLIRRNPLLWLLQFLFYTETRIYLLAYWSLLATMACLVVLYQNAKRSSSESKKHKA
PTITRKYFHFIVVATYIPGIIFDRPLLYVAATVCLAVFIFLEYVRYFRIKPLGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCAQKGSLGGARALVPYA
GVLAVGVGDTVASIFGSTMGEIRWPGTKKTFEGTMTSIFAQIISVALILIFDSGVDLNYSYAWILGSISTVSLLEAYTTQIDNLLLPLYLLILLMA*
10 >lcl|XP_002730315.1|Plus125440760..25442790 NW_048043 high density lipoprotein binding protein-like LOC100360876 __SEG__ ChrX {Rattus norvegicus} MTSNKTCIVQPDRCFQTEHHIMPSNSKINVNLLSDWDLDNDIVVRNPENCELAESWFVSMQKGTVKMSEVEFSIPFSSYKSLISPQKHLIDKIMEECGTFNIYFSNRKSN
LQQVIIRGPIENIEKIKKKFLQLLEEEKAQNYSLAVPVKSKYHQFLKNKNGGNLPNTCVKLGARAIFPTLKNKNQDLVTIIGKEEAVKEVQKELDLLLKDLEYVVEDSIL
INRKFHHYFIMRRDQLIREMTEVYAGMIINFTYEGKQSIRVTMKGEKACVEAAKKHVQQIFEPLGSHVTTQYVVPQKFYTFFMGPLCSKVQQIARDFKVQLAFPDKGKTT
MYVHPVVQETEKEKWGKNSKELVFSNERKSKTILISGQMENCKAAMEALEYLIPFTAEVQVPSHLHPYIIGHKGSGIKKIMSEFDVHTQVSQPGGNSDIISIMGLAAKVN
QAKIKLEKQINALQTEIEDRALRNFKLMFTLDAKYHSMITGHKGLFIAQICREHDVNIHFPKKSNREIQDQITITGYKNNTLAAKDAIMRMLYKIEKTVSKEIPVNPQVR
DSIFGFGGKYIHRLNEQLHVDIRLPPKGSWNTNITVIGLPEKVQEAIDHILDLEKYYLSVVIKYDSQLENLKNTCLYKITMEPPRFSGKKDVPHSSKPTPNSPHDDSEDF
HKLKQQTHPKTHPWRP*
11 >lcl|XP_345003.2|Plus129406484..29407038 NW_047563 lysophospholipase 1-like RGD1564018 __SEG__ Chr1 {Rattus norvegicus} MCGNNMNMSALMHTFVPAVQKVTTTVIFLHRLGDTGFDIIGLSPDSQEDESGIKQAAQTVKAFLLTVILGGFSQGGALFLYTALTTQQKLAGVTILSCWLPLWASFAQKP
INNADRDISILQCHGDYDPLVPLMFGSLTVERLKALANPTNVTFRIYEGMSHSLRQQEKLDVKHFIEKRLPPID*