SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ptro I    

ID / Description / Sequence
1 >lcl|XP_001134791.1|Plus1315658..317529 NW_003456646 uncharacterized protein C1orf65-like LOC735425 __SEG__ Chr1 {Pan troglodytes} MAGFSHFSQPPYRDLWEPPRPGGERESTQRLGGQRSGADSTACSRAGSPGAESEAGACWLHPHCSFTPRPRRRGCSNSPRGSRSLSDVARRPLERSRKHRPRSRRLEDAW
GETGTKPRPAWQPQTQLPPQRPQPCPHYPLAQGDSPPPYPGGAGTPLSGTFRVEKAQGGDQWAVPLGRHLGRWSPSSVPSERSSVPSQKFRRHSACVCAQKRDSSDQVES
LASRDSQPLASSKEMRSPHTQVLKSKLEEVVVSSQDQQIVALVLTRLKKAQRMRELQQQAAKAWEELKRSDQKVQMTLEQERRLLLRQSQEQWQEKEQRKTLQSPEQRGR
RRDSQRKNVPPGESRWKEQPEDQESPRQEKLEKVCAQAEHRKQCQVRRLREQEKMLRNLREQHSLQLQRRLVEACRKRHLHAVEGQKKVQDTNLSSLINYQARKVLMDCQ
AKAEELLRQLSLEQSFQRSQEIHQGLRKERQRELREKAQKEEEQLQQARWRAGESEEQRKMRKRILVELADEKIRQARSHVHKTTRDKVQHLRELNHLREKNHHILKLKA
EKEEKCHIEGIKEAIKKKEQRVQHISQGKDPNFQEFQKLPQASRREERAPANSSLDQMVLEAQLRACQQNRGY*
2 >lcl|XP_001138166.1|Plus1complement(503853..504809) NW_003457750 probable polyprenol reductase-like isoform 1 LOC737849 __SEG__ Chr12 {Pan troglodytes} MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLTQSLFLGAPFPSWLHG
LLRILGAAQFQGGELALSAFLVLVFLWLHSLRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQVPMDGRNAYITGKNLLMQARWFHILGMMMFIWSSAHQYKC
HVILGNLRKNKAGVVIHCNHTIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNLTWWLVVTNVFFNQALSAFLSHQFYKSKFVSYPKHRKAFLPFLF*
3 >lcl|XP_001147341.1|Plus1complement(4050293..4051186) NW_003456638 phosphatidylinositol N-acetylglucosaminyltransferase subunit C isoform 1 PIGC __SEG__ Chr1 {Pan troglodytes} MCAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPHWLLGTGLASSLIGYVLFDLIDGGEGRK
KSGQTRWADLKSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKL
KACTPRSYVGVTLLFAFSALGGLLSISAVGAILFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS*
4 >lcl|XP_001162301.1|Plus1complement(3730447..3732063) NW_003457485 dolichol kinase DOLK __SEG__ Chr9 {Pan troglodytes} MTRECPSPAPGPGAPLSGSVLAEAAVVFAVVLSIHATVWDRYSWCAVALAVQAFYVQYKWDRLLQQGSAVFQFRMSANSGLLPASMVMPLLGLVMKERCQTAGNPFFERF
GIVVAATGMAVALFSSVLALGITRPVPTNTCVILGLAGGVIIYIMKHSLSVGEVIEVLEVLLIFVYLNMILLYLLPRCFTPGEALLVLGGISFVLNQLIKRSLTLVESQG
DPVDFFLLVVVVGMVLMGIFFSTLFVFMDSGTWASSIFFHLMTCVLSLGVVLPWLHRLIRRNPLLWLLQFLFQTDTRIYLLAYWSLLATLACLVVLYQNAKRSSSESKKH
QAPTIARKYFHLIVVATYIPGIIFDRPLLYVAATVCLAVFIFLEYVRYFRIKPLGHTLRSFLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVP
YAGVLAVGVGDTVASIFGSTMGEIRWPGTKKTFEGTMTSIFAQIISVALILIFDSGVDLNYSYAWILGSISTVSLLEAYTTQIDNLLLPLYLLILLMA*
5 >lcl|XP_001171767.1|Plus112074411..12074677 NW_003457950 acyl-CoA-binding domain-containing protein 7-like LOC746717 __SEG__ Chr15 {Pan troglodytes} MSLQADFDMVTEDVRKLKTRPDDEELKELYGLYKQAVIGNINIECSEMLELKGKAKWEAQNPQKGLSEEDMMSAFISKAEELIEKYGI*
6 >lcl|XP_003309116.1|Plus1complement(6154873..6155892) NW_003456693 methylglutaconyl-CoA hydratase, mitochondrial-like LOC470410 __SEG__ Chr2A {Pan troglodytes} MAAAVAAAPGALGSLHAGGARLVAACSAWLCPGLRLPGSLAGRRVGPAIWAQGWVPAAGGPAPKRGYSSEVKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKM
LSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKERAKMSSSEVGLFVSKVRAVINDIANLPVPTIAAIDGLVLGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGG
TQRLPRAIGMSLAKELIFSARVLDGQEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKE
KRPPRYKGE*
7 >lcl|XP_003310292.1|Plus1complement(806696..808261) NW_003456944 proactivator polypeptide-like 1-like LOC100609404 __SEG__ Chr4 {Pan troglodytes} MLCALLLLPSLLGATRASPTSGPQECAKGSTVWCQDLQTAARCGAVGYCQGAVWNKPTAKSLPCDVCQDIAAAAGNGLNPDAPESDILALVMKTCEWLPSQESSARCKWM
VDAHSSAILSMLRGAPDSAPAQVCTALSLCEPLQRHLATLRPLSKEDTFEAVAPFMANGPLTFHPRQAPEGALCQDCVRQVSRLQEAVRSNLTLADLNIQEQCESLGPGL
AVLCKNYLFQFFVPADQALRLLPTQELCRKGGFCEELGAPARLTQVVAMDGVPSLELGLPRKQSEMQMKAGVTCEVCMNVVQKLDHWLMSNSSELMITHALERVCSVMPA
SITKECIILVDTYSPSLVQLVAKITPEKVCKFIRLCGNRRRARAVHDAYAIVPSPEWDAENQGSFCNGCKRLLTVSSHNLESKSTKRDILMAFKGGCSVLPLPYMIQCKH
FVTQYEPVLIESLKDMMDPVAVCKKVGACHGPRTPLLGTDQCALGPSFWCRSQEAAKLCNAVQHCQKHVWKETPLHAGEHA*
8 >lcl|XP_003310346.1|Plus1complement(4940555..4941313) NW_003456958 cytosolic acyl coenzyme A thioester hydrolase-like LOC100609278 __SEG__ Chr4 {Pan troglodytes} MIKEAGAIISTRHCNPQNGDRCVAALARVECTDFLWPMCIGEVAHVSAEITYTSKHSVEVQVNMMSENILTGAKKLTNKATLWYAPLSLTNVDKVLEEPPVVYFRQEQEE
EVQKRYKTQKLERMETNWRNGDIVQPVLNPEPNTVSYSQSSLIHLVGPSDCTLHSFMHEGLTMKVMDEVAGILAARHCKTNLNTASMEAINFDNKIRKVCIKTISGRMTF
TSNKSVEIEVLVDADCVVDSSQKRYRAAGVFT*
9 >lcl|XP_003310774.1|Plus1complement(6851218..6851625) NW_003457034 fatty acid-binding protein, epidermal-like LOC737086 __SEG__ Chr5 {Pan troglodytes} MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRK
LKDGKLVVECVMNNVTRTRIYEKVE*
10 >lcl|XP_003311263.1|Plus1complement(3601915..3602610) NW_003457113 acyl-protein thioesterase 2-like LYPLA2 __SEG__ Chr6 {Pan troglodytes} MCGNTMSVPLLNNAATVSGAERETAVVIFLHGLGDTGHSWADALSAIRLPHVKYICSHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNG
IPANQIILGGFSQGRALSLYTALTCPHPLAGILALSCWPPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALMAEKLWSVVTPARVQFQTYLGVMHSSCPQEMAAV
KEFLEKLLPPV*
11 >lcl|XP_003314913.1|Plus1122816..123223 NW_003457966 fatty acid-binding protein, epidermal-like LOC743807 __SEG__ Chr15 {Pan troglodytes} MATVKQLEGRWRLVDSRGFDEYVKELGMGIALRKMDTIAKPDCIITCDGKNLTIKTESTLKTTQFSCTLAEKFEETTADGRKTQTVCSFTDGALVQRQEWDGKENTIRRK
LKDGKLVVDCVMNSVTCTRIYEKVE*
12 >lcl|XP_003316106.1|Plus1complement(215125..215571) NW_003458448 acyl-protein thioesterase 2-like LOC455664 __SEG__ Chr19 {Pan troglodytes} MGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAAKGSGKGLTILQCRGELDPMVPIRFGTLTA
VVTPARVQFKIYSGVMHSCCPQEMAAVKEFLEKLLPSV*
13 >lcl|XP_003317125.1|Plus1complement(258623..259030) NW_003458610 fatty acid-binding protein, epidermal-like LOC470130 __SEG__ Chr22 {Pan troglodytes} MATVQQLEGRWRLVDSEGFDEYMKELGVGIALREMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADSRKTQTVCNFTDGALVQHQEWDGKESTITRT
LKDGKLVVERVMNHVACTRIYEKVQ*
14 >lcl|XP_003319022.1|Plus1complement(29264..30889) NW_001252916 testis-specific chromodomain protein Y 1 CDY1 __SEG__ ChrY {Pan troglodytes} MASQEFEVEAIVDKRQDKKGNTQYLVRWKGYDKQDDTWEPEQHLMKCEKCVHDFNRRQAEKQKKLTWTTTSRIFSNNARRGTSRSTKANYSKNSPKTLVTDKHHRSKNRK
LFAASKNVRRKAASILSDTKNIEIINSTIETLAPDSPFDHKKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSRPGAEQTGIQNKTQIHPLMSQMSGSGTASMA
TGSATQKGIVVLIDPLAANGTTDMHTSVPRVKGGQRNMTDDSRDQPFIKKMHFTIRLTESASTYRDIVVKKEDGFTQIVLSTRSTEKNALNTEVIKEMVNALNSAAADDS
KLVLFSAAGSVFCCGLDFGYFVKHLRNDRNRASLEMVDTIKNFVKTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQTPDGCSSITFPKMMGKA
SANEMLIAGRKLTAREACTKGLVSQVFLTGTFTQEVTIQIKELASYNPIVLEECKALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF*
15 >lcl|XP_003319023.1|Plus1192927..194552 NW_001252916 testis-specific chromodomain protein Y 1 CDY1 __SEG__ ChrY {Pan troglodytes} MASQEFEVEAIVDKRQDKKGNTQYLVRWKGYDKQDDTWEPEQHLMKCEKCVHDFNRRQAEKQKKLTWTTTSRIFSNNARRGTSRSTKANYSKNSPKTLVTDKHHRSKNRK
LFAASKNVRRKAASILSDTKNIEIINSTIETLAPDSPFDHKKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSRPGAEQTGIQNKTQIHPLMSQMSGSGTASMA
TGSATQKGIVVLIDPLAANGTTDMHTSVPRVKGGQRNMTDDSRDQPFIKKMHFTIRLTESASTYRDIVVKKEDGFTQIVLSTRSTEKNALNTEVIKEMVNALNSAAADDS
KLVLFSAAGSVFCCGLDFGYFVKHLRNDRSRASLEMVDTIKNFVKTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQTPDGCSSITFPKMMGKA
SANEMLIAGRKLTAREACTKGLVSQVFLTGTFTQEVTIQIKELASYNPIVLEECKALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF*
16 >lcl|XP_003319186.1|Plus1complement(30872..32497) NW_001252924 testis-specific chromodomain protein Y 1 CDY2A __SEG__ ChrY {Pan troglodytes} MASQEFEVEAIVDKRQDKKGNTQYLVRWKGYDKQDDTWEPEQHLMKCEKCVHDFNRRQAEKQKKLTWTTTSRIFSNNARRGTSRSTKANYSKNSPKTLVTDKHHRSKNRK
LFAASKNVRRKAASILSDTKNIEIINSTIETLAPDSPFDHKKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSRPGAEQTGIQNKTQIHPLMSQMSGSGTASMA
TGSATQKGIVVLIDPLAANGTTDMHTSVPRVKGGQRNMTDDSRDQPFIKKMHFTIRLTESASTYRDIVVKKEDGFTQIVLSTRSTEKNALNTEVIKEMVNALNSAAADDS
KLVLFSAAGSVFCCGLDFGYFVKHLRNDRNRASLEMVDTIKNFVKTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQTPDGCSSITFPKMMGKA
SANEMLIAGRKLTAREACTKGLVSQVFLTGTFTQEVTIQIKELASYNPIVLEECKALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF*
17 >lcl|XP_003319187.1|Plus1169157..170782 NW_001252924 testis-specific chromodomain protein Y 1-like LOC100611625 __SEG__ ChrY {Pan troglodytes} MASQEFEVEAIVDKRQDKKGNTQYLVRWKGYDKQDDTWEPEQHLMKCEKCVHDFNRRQAEKQKKLTWTTTSRIFSNNARRGTSRSTKANYSKNSPKTLVTDKHHRSKNRK
LFAASKNVRRKAASILSDTKNIEIINSTIETLAPDSPFDHKKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSRPGAEQTGIQNKTQIHPLMSQMSGSGTASMA
TGSATQKGIVVLIDPLAANGTTDMHTSVPRVKGGQRNMTDDSRDQPFIKKMHFTIRLTESASTYRDIVVKKEDGFTQIVLSTRSTEKNALNTEVIKEMVNALNSAAADDS
KLVLFSAAGSVFCCGLDFGYFVKHLRNDRNRASLEMVDTIKNFVKTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQTPDGCSSITFPKMMGKA
SANEMLIAGRKLTAREACTKGLVSQVFLTGTFTQEVTIQIKELASYNPIVLEECKALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF*
18 >lcl|XP_507901.2|Plus1complement(1809559..1810377) NW_003457620 cholesterol 25-hydroxylase CH25H __SEG__ Chr10 {Pan troglodytes} MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDILCSWVPALRRYKIHPDFSPSARQLLPCLGQTLYQHVMFVFPVTLLHWARS
PALLPHEAPELLLLLHHILFCLLLFDMEFFVWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNF
PWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR*
19 >lcl|XP_525275.1|Plus16322649..6323119 NW_003458541 uncharacterized protein C20orf79-like LOC469890 __SEG__ Chr20 {Pan troglodytes} MWKRSDHQPKIKAEDGPLVGQFEVLGSVPEPAMPHPLELSEFESFPVFQDIRLHIREVGAQLVKKVNAVFQLDITKNGKTILRWTIDLKNGSGDMYPGPARLPADTVFTI
PESVFMELVLGKMNPQKAFLAGKFKVSGKVLLSWKLERVFKDWAKF*
20 >lcl|XP_527993.1|Plus1complement(2402370..2402777) NW_003457188 fatty acid-binding protein, epidermal-like LOC472619 __SEG__ Chr7 {Pan troglodytes} MATVQQLEGRWRLVDSEGFDEYMKELGVGIALREMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSGTLGEKFEETTGDGRKTQTVCNFTDGALVQHQEWDGKESTVTRK
LKDGKLVVERVMNHVACTRIYEKAQ*