SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus I    

ID / Description / Sequence
1 >lcl|NP_001004173.1|Plus1complement(269209..>269763) NT_039198 sphingosine-1-phosphate phosphatase 2 Sgpp2 __SEG__ Chr1 {Mus musculus} QDILGGVLITAVLIALTYPAWTLIDSLDSASPLFPVCVIVVPFLLCYNYPVSDYYSPTRADTTTIVAAGAGVTLGFWINHFFQLVSKPTPSLPVIQNIPPLTTDMLVLGL
TKFMVGIMLILLVRQLVQKLSLQVLFSWFKVVTRNKEARRRLEIEVPYKFVTYTSVGICATTFVPMLHRFLGLL*
2 >lcl|NP_001028413.2|Plus11158284..1162036 NT_039716 hypothetical protein LOC211208 Gm382 __SEG__ ChrX {Mus musculus} MNSKRNSASQQNKSAQKENHYKNPNDVVRMSRNDKEVNQHLEQGNFSGNPEETAESSNSNIFKAGEISNLTRIFHVLLEEEKYLTQFGEGTLAKFYAHIMENTGVNLESS
FVKDQGLYVTVFGNPEAVTNAENEIFKWCQKQYLPLTLISKQEHCFFLNQTGNKSQDLEQEGQINTQITSPHNQNNSINSVDVNQTKMKSSDGSLSTSARSNKGDIQILE
MEKSFNPLTVKPYLQASDIFQETEEHVPFELSSAKETDLDINEGQLHVDQIGCLKNDMIKKTSTITEGMMMTFQDSGTRSLKRHFLEEILDTSEDSTGQSQSESISDYMT
QHSDLDSSGELFNEADDNDDDYIASSIFAPSWLHRFIIGTKGEEISEITECVPKVQIHFTAKDKITLKGPIDDVNYAQEKFDIIVKDLMSKMEYTEINSDSKFYKYLTGN
NGEILNRITEKNQVSITMFPENESNYSIRIEGESLGVHQAKKELLDLANNLEEEYSQDIIIKHQFHHILIGQKGERVREICKKFPDVILNFPHPAEKSDIVQLIGPRYES
EKCAQYLENMLTDIKENNYSISVPIIKKLHKRIIGKGVSNIRKISEATNTKITFPPESCNSEEFIITGYPENCEIARNWILSLQQELADTAEEEIIIPANLYKHLTNPKE
CLLNSIIEECGKIHLHFPKGKSNLNKIIIMGTIENVEKAKTKLLKLSEEEQAKNYSETLHIKSKYHQFLLNKNGGNISKICDETGTCVFFPNPTNKDQETITITGTEESV
KEVQKQLDDLVKDFENEVDDSILINRRFHHYFVMRRGQLLKEMAEDYGGVVITFSYSGRQNTKVTIRGAKPCVEAAKKHIKEIFEPLGSQITTRYVLPHSFQPFIMGPIS
SRIQQIARDYKVEIKFPDIEKPALNMDLGTHEKGKEKWKRTAKEIAPNSPRKGDTIFISGQVENCKAATEALASIIPVTTEVHVPLHLQPYIIGHKGSGLRKLVKEYEVH
MQVSQPGKNSDIISIMGLSANVEQAKIKLQKRVKSLQMEVEDRTLRNFKLMFNLDPKYQAKITGHKGLLITQICTEHDVTIHFPKKGTHDMQEQITITGYKENTLAARDA
IMRLLHKIEKTISKEITLNQQVRGNVIGVRGKTINKIMDQYQVDIRLPPKGLYNPNITVTGLADNVEKAIEHILNLEKYYLSAAINHGSQQEQPKSMSLCNIAMTPSKSF
VRKYVPCYAKTTTKLPDVDNCEHFPRLKQRTSSKTHPSKL*
3 >lcl|NP_001034134.1|Plus15801709..5802602 NT_039185 phosphatidylinositol N-acetylglucosaminyltransferase subunit C Pigc __SEG__ Chr1 {Mus musculus} MCAQRVTDTPEVKWQKVLYERQPFPDNYVDQRFLEELRKNIYARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPQWLFGTGLASSLVGYVLFDLIDGGDGRK
KSGRTRWADLKSTLVFITFTYGFSPVLKTLTESVSTDTIYAMAVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKL
KAYTPRSYVGVTLLFAFSAFGGLLSISAVGAILFALLLFSISCLCPYYLIHLQLFKENIHGPWDEAEIKEDLSRFLS*
4 >lcl|NP_001104614.1|Plus1complement(1003671..1005707) NT_039716 hypothetical protein LOC214308 Gm381 __SEG__ ChrX {Mus musculus} MTSKRQYIVYPNRSLQRENHLTNLNSRRKVNFPSSSCNSENNISIRKPENHEICHNWILPIPKNAAKDSEVEIPISPSLHRSLTDSKKSLIGSIIEECGKVHIHFPSNNQ
GPQKVIISGSMEIVEKTKKKLLQLAEEEQAKSYSVAIPVKSKYHQFLMSKNGGNLQKICEKTGARIIFPTFKNKDQESVTIIGTEEAVKNVQKEVEVLLKNLEDVVEDSI
LISPKFHNYFVMQRGQLLREIIKEYGGVFITFSYVGKQSTKVTIKGAKACVEAAKKHIQGIFDPLGSQVTTQCVIPPKFHPFIMGPICSRIQQIARDCKVQIKFPDTEKA
IRKTHPEVQKMGKEKGGKNIKKPASTSPKKSDTMSISGKAENCKEAAQALETLVPVTAEVQVPFHLHPYIIGHKGSGLHKLIKDFEVHIQVSQPGGNFHIISIMGLEANV
KQVKTKLQNQVKALQMELDDQPLRNFRKTFRLDPKYHSKIFGNKGILISQICTEYDVTVHFSKKGNNSIQDQITIAGSKINILGAYDAIMNLLHKIEKTVSKEIPLNHHV
CANIFGFGAKSIQKIMEQFQVDVRVHSKGSCSNSSIVVSGSSCNVQKAIEYILSLEKHFLSVGKSDPPLDHHKHGGLYNTAARTSTSFGKRNSLRNAKPTTYPPRADNSE
DFPKLKHQTSPKFQPWRP*
5 >lcl|NP_034020.1|Plus1complement(27660615..27661511) NT_039687 cholesterol 25-hydroxylase Ch25h __SEG__ Chr19 {Mus musculus} MGCYNGSELQDLGCSSQLLLQPLWDTIRTREAFTRSPIFPVTFSIITYVGFCLPFVVLDVLYPWVPILRRYKIHPDFSPSVKQLLPCLGLTLYQHLVFVFPVTLLHWVRS
PALLPQEAPELVQLLSHVLICLLLFDTEIFAWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSFWELLSLTFFDVLNVAVLRCHPLTIFTFHVINIWLSVEDHSGYDF
PWSTHRLVPFGWYGGVAHHDMHHSQFNCNFAPYFTHWDKMLGTLRSAPLPESLCACGERCVNSRERCAVHLIQKKKQT*
6 >lcl|NP_067269.1|Plus141536652..41536915 NT_096135 diazepam-binding inhibitor-like 5 Dbil5 __SEG__ Chr11 {Mus musculus} MSQVEFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKMDAMRIYIAKVEELKKKEPC*
7 >lcl|NP_073727.2|Plus1complement(11610561..11611880) NT_039618 acyl-coenzyme A thioesterase 10, mitochondrial precursor Acot10 __SEG__ Chr15 {Mus musculus} MKRAAMRLWTLNKGLLTHGRGLSQGSQYKISEPLHIHQVQVKLREIVGISTVWRDHVQAMEERKLLHSFLPKSQKVLPPRKIRDSYIEVLLPLGTDPELRDKYVTVQNTV
RFGRILEDLDSLGVLVCYMHNHNHSTNMSLLSIVTVLVDKIDMCKHSLSPEQDIKFTGHVSWVGNTTMEVKMKMFQLHDDETYWPVLDATFVMVAQDSENKRPAFVNPLI
PENKEEEELFTQGELNKSRRIAFSTSSLLKVAPSSEERNIIHELFLSTLDPKTISFQSRILPPKAVWMEDTKLKSLDICHPQERNVFNRIFGGFLMRKAYELAWATACSF
GGSRPYVVTVDDIMFQKPVEVGSLLFLSSQVCFTQGNYIQVRVHSEVFSLDSREHMTTNVFHFTFMSEKEVPLIFPKTYGESMLYLDGQRHFKSMSTPVTLKKDYPVEP*
8 >lcl|NP_079766.3|Plus185690781..85691251 NT_039207 hypothetical protein LOC66328 1700010M22Rik __SEG__ Chr2 {Mus musculus} MWKRPDPQAKIKAGDRPQTCQSLALGSATESALPQALKLSDFQNFSVFEDISQHIKEVGAQLVKKVNAIFQLDITKDGKTILQWTIDLKNGAGDMYLGSARLPADTVFII
PDSVFTELVVGKINPQKAFLAGKFKVRGKVLLSQKLERIFREWAKI*
9 >lcl|NP_081875.1|Plus131333947..31335497 NT_109320 lysophosphatidylcholine acyltransferase 2B Lpcat2b __SEG__ Chr5 {Mus musculus} MAHQNQHQDTIDSTEVEVWDSRTAQEVNKSLYPPAVDSPFTLNTHLSAWRWACTIILGTVLVPVRVSCIVFLLILLWPVAVLSAINLPTQPTKPIRRWRKHLIKSALVFL
FRLGFFFAGFLVKVKGKKATREEAPIFVSAPHSTFFDAIAVVVAGLPSVVSDSQLARVPLAGKCILVTQPVLVKREDPNSRKTTRNEILRRVKSKMKWPQILIFPEGLCT
NRSCLVTFKLGAFSPGVPVQPVLLRYPNSLDTVTWTWNGFSGFQVCMLTLSQLFTRVEVEFMPVYIPSEEEKKDPILFANTVRIKMANALKLPVTDHSLEDCKLMISAGA
LQLPMEAGLVEFTKISQKLKLDWDNIHKHLDQYASFAVSSKGGKIGIEAFSRYLKLPISEPLRQLFSLFDRNQDGTIDFREYVIGLTVLCNPSNTEKILQMSFKLFDLDE
DGYVTERELTTMLQAAFGVPDLDVSTLFQQMAGKDSDQVSYRTFRRFALKHPAYAKLFHSYIDLQAAYIYSLPREV*
10 >lcl|NP_083093.2|Plus1complement(5407..5835) NT_039198 long-chain-fatty-acid--CoA ligase 3 isoform a Acsl3 __SEG__ Chr1 {Mus musculus} MNNHVSSTPSTMKLKQTINPILLYFIHFIISLYTILTYIPFYFLCESKQEKPNQIKAKPVSSKPDSAYRSINSVDGLASVLYPGCDTLDKVFMYAKNKFKNKRLLGTREI
LNEEDEIQPNGKIFKKVR*SLLLCGSPLLVHLA
11 >lcl|NP_780458.2|Plus13480347..3481924 NT_039302 proactivator polypeptide-like 1 Psapl1 __SEG__ Chr5 {Mus musculus} MGTMLCALILWSGLLGAARASPISVPRECAKGSEVWCQDLQAAAKCRAVRHCQSAVWNKPTVKSLPCSVCQDVAAAAGNGVNPGATESDILTSVMKTCEWLPSQESSAKC
KWMVNNHSAAVLSMLSGAQETDLASVCTALTLCEPLQRHLAETTSERPLTQEDANEVMAPFLSNGALSFHPSQMPEGAVCHDCVQLISLLQDALESNLTLAEVTVQNQCQ
SMGPGLAALCENYIHRQFVPAKQTLQGLPPQEVCRKGGFCERESAHWLTRVAAVDGVPSLEMEMPRTNELQMQLGLTCDVCLNLVQELDKWLVTNSTEALISHTLERVCT
VVPEPLVQQCITLVDTYSPELVQLMSKVTPEKVCETIKLCGSKRRARSISRAVATTPSLPVDEENQGSFCQGCKRLLGMSSQNLDHKSTKRDILNAFKGGCRILPLPYVM
QCNRFVAEYEPVLIESLKFMMNPTDLCKKMGACHGPKTPLLGTDQCVMGPSFWCKSPEAAEMCNALEHCQRLVWKKPVSKINEQP*
12 >lcl|NP_808316.1|Plus1complement(7742695..7744299) NT_039206 dolichol kinase Dolk __SEG__ Chr2 {Mus musculus} MTRQCPPQESGAALSGSVLAEAAVVFAVVLSIHAAVWDRYSWCAVALAVQAFYVQYKWDRLLQQGNAVFQFRMSANSGLLPASMVMPLLGLVMKERCQTAGNPYFERFGI
VVAATGMAVALFSSVLALGITRPVPTNTCAISGLAGGVIIYIMRHSLSVGEVIEVLEVLLIFVYLNMILLYLLPRCFTPGEALLVLGGISFVLNQLIKRSLTESQGDPVD
FFLLVVVVGMVLMGVFFSTLFVFMDSGTWASSIFFHLMTCVLGLGVVLPWLHWLIRRNPLLWLLQFLFYTETRIYLLAYWSLLASVACLVVLYQNAKRSSSESKKHRAPT
ITRKYFHFIVVATYIPGIIFDRPLLYVAATVCLAVFIFLEYVRYFRIKPLGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKDSLEGARALVPYAGV
LAVGVGDTVASIFGSTMGEIRWPGTKKTFEGTMTSIFAQIISVALILIFDSGVDLNYSYAWILGSISTVSLLEAYTTQIDNLLLPLYLLILLMA*
13 >lcl|XP_001480523.1|Plus1complement(597426..597896) NT_166306 acyl carrier protein, mitochondrial-like Gm4459 __SEG__ Chr7 {Mus musculus} MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTTLCPEGIRRRPEALQSALALAQVPGTVTHLCRQYSDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGL
DSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE*