SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmul I    

ID / Description / Sequence
1 >lcl|XP_001083208.1|Plus1complement(705809..706627) NW_001124216 cholesterol 25-hydroxylase CH25H __SEG__ Chr9 {Macaca mulatta} MSYQNSSDPQVLCSSEQLFLQPLWDHLRSWEALIQSPFFPVIFSITTYVAFCLPFVVLDILCSWVPALRRYKIHPDFSPSARQLLPCLGQTLYQHVMFVFPVTLLHWASR
PALLPHEAPELLLLLHHIVFCLLLFDTEFFVWHLLHHKVPWLYRTFHKVHHQNPSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTSLTFHVVNIWLSVEDHSGYNF
PWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVTAR*
2 >lcl|XP_001084415.1|Plus132189..33169 NW_001115233 mesoderm-specific transcript homolog protein-like isoform 1 LOC697467 __SEG__ Chr3 {Macaca mulatta} MREWWVQVGLLAVPLLAVYLHIPPPQLSPALHSWKPSGKFFTYKGLRIFYQDSVGVVGSPEIVVLLHGFPISSYDWYKIWEGLTLRFHQVIALDFLGFGFSDKPRPHHYS
MFEQASIAEALLRHLGLQNRRINLLSHDYGDTVAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLKDGGVLSPILTRLMNFFVFSRGLTPVFGPYTRPSE
SELWDMWAGIRNNDGNLVIDSLLQYINQRKKFRRHWVGALASVTIPIHFIYGLLDPVNPYPEFLELYRKMLPQSTVSILNDRISHYPQLEDPMGFLNAYMGFINSF*
3 >lcl|XP_001088143.2|Plus1complement(5648..6157) NW_001096895 ethanolamine kinase 1-like LOC696957 __SEG__ Chr11 {Macaca mulatta} MLRGRPRSSADNRNFSRERPGLSSAAVQTRIGDSAASRRSPAARPPVRAPPALPRGRPGTEGSTSLSAPAVLVVAVAVVVVVVSDVSWAMANYIHVPPGSPEGPELNVTV
QDQEEQRCREGALSLLQHLRPHWDPQEVTLQVTPTPQLWVSYVPHAAVGVLTTIASVPR*
4 >lcl|XP_001089179.1|Plus123009..23989 NW_001114263 mesoderm-specific transcript homolog protein-like isoform 3 LOC702492 __SEG__ Chr3 {Macaca mulatta} MREWWVQVGLLAVPLLAVYLHIPPPQLSPALHSWKPSGKFFTYKGLRIFYQDSVGVVGSPEIVVLLHGFSASSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHHYS
IFEQASIVETLLRHLGLQNRRINLLSHDYGDTVAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQKLFKDGGVLSPILTRLMNFFVFSRGLTPVFGPYTRPSE
SELWDMWAGIRNNDGNLVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPVNSYPEFLELYRKMLMWSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF*
5 >lcl|XP_001090634.1|Plus17447608..7448078 NW_001095148 uncharacterized protein C20orf79 C10H20orf79 __SEG__ Chr10 {Macaca mulatta} MWKRSGHQPKIKAEDGPLAGQFEVLGSVPEPAMPHPLELSELESFSVFEDIRLHIREVGAQLVKKVNAIFQLDITKDGKIILQWTIDLKNGSGDMYPGPARLPADTVFTI
PEPVFMELVLGKMNPQKAFLAGKFKVSGKVLLSQKLERVFKDWAKF*
6 >lcl|XP_001099615.1|Plus1complement(71900..72316) NW_001100388 cellular retinoic acid-binding protein 2 CRABP2 __SEG__ Chr14 {Macaca mulatta} MPNFSGNWKIIRSENFKDLLKVLGVNVMLRKTAVAAVSKPVVEIKQEGDTFYIKTSTTVCTTEINFKVGEELEEQTVDGRPCKSPVKRESENKMFCEQKLLKGEGPKTSW
TRELTNDRELILTMRADDVVCTRVYVRE*
7 >lcl|XP_001100450.1|Plus1complement(3208211..3209104) NW_001109115 phosphatidylinositol N-acetylglucosaminyltransferase subunit C isoform 1 PIGC __SEG__ Chr1 {Macaca mulatta} MCAQPVTSTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPHWLFGTGLASSLIGYVLFDLIDGGEGRK
KSGQTRWADLKSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKL
KACTPRSYVGVTLLFAFSALGGLLSISAVGAILFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS*
8 >lcl|XP_001103096.1|Plus1complement(4456343..4456651) NW_001095180 acyl-CoA-binding protein DBI __SEG__ Chr10 {Macaca mulatta} MSQAEFEKAAEEVKHLKTKPADDEMLFIYGRYKQATVGDVNTERPRMLDFTGKAKWDAWNELKGTTKEDAMKAYINKVEELKKKIRDMSDWIWLLGHVFLLN*
9 >lcl|XP_001106967.1|Plus1232222..233415 NW_001118148 acetyl-CoA acetyltransferase, cytosolic isoform 2 ACAT2 __SEG__ Chr5 {Macaca mulatta} MNAGSDPVVIVSAARTIIGSFNGALATVPVQDLGSTVIKEDLKRATVVPEDVWEVIFGHVLAAGCGQNPVRQASVGAGIPYCIPAWSCQMICGSGLKAVCLAAQSIGIGD
SSTVVAGGMENMSKAPHLAHLRTGLKIGEMPLTDSILCDVLTDAFHNCHMGITAENVAKKWQVVREDQDEIAVLSQNRTENTQKASHFDKEVVAVLVSSRKGLIEVKTDE
FPRHGSNIEAMSTLKPYFLTDGMGTVTPANASGINDGAAAVVHMKKSEADKRGLTPLARIVSWSQVGVEPSIMGIGPILATKQAVTKADWSLEDVDIFGINEAFAALSVV
TVKELGLNPEKVNIEGGAIAVGHPLGAYGCRILVTLLHTLERMGGSCGIVALCIGGGMGIAMCVQRG*
10 >lcl|XP_001108570.2|Plus1222..392 NW_001111241 fatty acid-binding protein, heart-like LOC717237 __SEG__ Chr1 {Macaca mulatta} MTKPTTIIEKNGDILTLKTHSTFKNTEINFKLGVEFDETTADDRKVKVSHGNRGWE*
11 >lcl|XP_001109312.1|Plus12065892..2067508 NW_001101655 dolichol kinase-like DOLK __SEG__ Chr15 {Macaca mulatta} MTRECPSPAPGPGAPLSGSVLAEAAVVFAVVLSIHATVWDRYSWCAVALAVQAFYVQYKWDRLLQQGSAVFQFRMSANSGLLPASMVMPLLGLVMKERCQAAGNPFFERF
GIVVAATGMAVALFSSVLALGITRPVPTNTCVILGLAGGVIIYIMKHSLSVGEVIEVLEVLLIFVYLNMILLYLLPRCFTPGEALLVLGGISFVLNQLIKRSLTLVESQG
DPVDFFLLVVVVGMVLMGIFFSTLFVFMDSGTWASSIFFHLMTCVLSLGVVLPWLHRLIRRNPLLWLLQFLFQTDTRIYLLAYWSLLATLACLVVLYQNAKRSSSESKKH
QAPTIARKYFHLIVVATYIPGIIFDRPLLYVAATVCLAVFIFLEYVRYFRIKPLGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLIPRPCTQKGSLGGARALVP
YAGVLAVGVGDTVASIFGSTMGEIRWPGTKKTFEGTMTSIFAQIISVALILIFDSGVDLNYSYAWILGSISTVSLLEAYTTQIDNLLLPLYLLILLMA*
12 >lcl|XP_001111010.1|Plus1<124..447 NW_001114623 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like LOC718400 __SEG__ Chr3 {Macaca mulatta} DGCPQRGAVHPLLSSAMGLLAFLKTQFVLHLLVGFVFVVSGLVINFVQLCTLALWPVSKQLYRRLNCRLAYSLWSRECLLGQSPPPGAPVGAARDHGRGSRGLSGQK*
13 >lcl|XP_001112404.1|Plus1complement(14207987..14208457) NW_001101663 acyl carrier protein, mitochondrial isoform 2 NDUFAB1 __SEG__ Chr15 {Macaca mulatta} MASRVLSAYVRRLPAAFAPLPRVPMLAVAQPLSTGLCSAGTQTRLGPLQPALRLAQVPGRVTQLCRQDSDMPPLTLEGIQDCVLYVLKLYDKIDPEKLSVDSHFMKDLGL
DGLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE*