SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom I    

ID / Description / Sequence
1 >lcl|XP_001363761.1|Plus1complement(2343133..2344800) NW_001581837 sterol O-acyltransferase 1-like LOC100012230 __SEG__ Chr1 {Monodelphis domestica} MMGEEKTSVRSRCLTSKENDEEKKSPPKEDTLHTSEETCQTPENSKFDSEQHLKKKILLTVEAEQLKPYFMKEVGTHFDEFVTNLIEKSASLDISGSVNTSFAVLNGGKN
HHRDVILRNPPEQGKLFIMRKSLLDELFEVDHIRTIYHMFIAVLILFVLSTVVVDYIDEGRLVLEFSLLSYAFGKLPHVLLIWLYMFLATLIISYVLLERWAKGYTESSR
PFFRSFCYGMLFMFFQILVLGCGSTYTVLAYTLPPASRFIVILEQVRFIMKAHSFIRENVPRVLAAAKEKSRTVPVPQVSQYLYFLFAPTLIYRDNYPRNSTIRWSYVAT
RFAQVFGCLFYTYYIFERLCVPLFRNIKQEPFSLRVLVLCIFNSILPGVLMLFLSFFVILHCWFNAFAEMLRFGDRMFYRDWWNSTSYANYYRTWNVVVHDWLYYYAYKD
FLWFFSRRFKTAAMMSVFAVSAIVHEYALALCFSFFYPVLFVLFMFFGMIFNFIANDNRKRPIWNIMMWTSLFLGHGILVCLYSHEWYARQQCPLKNSTFLDYIRPRSWT
CHYVF*
2 >lcl|XP_001367859.1|Plus1complement(59930982..59931779) NW_001581868 elongation of very long chain fatty acids protein 6-like LOC100020799 __SEG__ Chr2 {Monodelphis domestica} MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLSLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQSFYIGPVSK
FWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGLVVNYLVFYWM
QQDQCHSHVQNIIWSSLMYVSYFVLFCHFFFEAYIGKMRKTRKAE*
3 >lcl|XP_001368167.2|Plus1complement(3539707..3541266) NW_001581840 dolichol kinase-like LOC100013804 __SEG__ Chr1 {Monodelphis domestica} MLGEATIVFMVVLSIHASVWDRYSWCTVALAVQAFYVQYKWDRLLQQGAAVFQFRTTANSGLLPASMVIPLLGVVMKKCCESAENVYFERFGIVVAATGMALALFLSILA
LGITRPVPTNTCVISGMAGSVIIYIMKHSLSVAEVIEVLEVLLIFVYLNMILLYLLPRCFTPGEALLILGGISFALNQLIKRSLNVIQGRGDPVDFFLLVVVVGMVIMGI
FFSMFFAFMDSGTWTSSLFFHLMTGVLGLGVIMPWLYHLIRENPLLWLFQFLFQTDTRIYLLIYWSLLAASACIVVMYQNAKRLSSESKKHQASTVTRKYFHFIIVATYV
PGLIYDRLLLYVAAVVCLAVFIILEYIRLFRIKPLGQTLRNLLSLFLDERDSGPLILTHIYLLLGMSLPLWLFPRPCAPKGSLGSVGALVPYAGVLAVGVGDTIASIFGS
TVGEIHWPGTVKTFEGTMSSIFAQIISVALILIFDSKVDLNSSYAWILGSITIISLLEAYTTQIDNLMLPLYLQILLMA*
4 >lcl|XP_001370361.1|Plus1complement(1747215..1747478) NW_001581883 diazepam-binding inhibitor-like 5-like LOC100016546 __SEG__ Chr2 {Monodelphis domestica} MAQVEFELACATVKQLTGPVSDEEKLLVYSYYKQATVGDINIPCPEVTDFKAKAKWEAWNCRKGMSKLDAMRIYVSKVEELKKKQSS*
5 >lcl|XP_001374192.1|Plus1complement(321586..323721) NW_001587056 oxysterol-binding protein 1 OSBP __SEG__ ChrX {Monodelphis domestica} MVVKAKTTRSSLLGIGITVAQGPDSLEGWLSKWNNSLKSYQPRWFMLSHGLLSYYCDKAEMHNTCQGTISLASATITVEDSCSFVISNGDSHTYRLRANSEIEQQDWIKA
LTLAKGKAVKMPTHFDDSEEEASTSSRQAEKMDLQKSLHTLSQKVDDVTTYTDLVASQGQVLQSALRELESIKIPKESHAKMEQVTEHAVLLKDTSSTMTNICKDFLKLV
LIQSEKWQKSLQLEKEKRIQLEEALEQLAEQHNRLERTLQSDAGKETEKGEAKQESGARPKVAKVPGDPGQAHAQSEIHGASRPSGQYKQHGKKIKKVKRIQIPSKPTYS
LNLWSMIKNYIGKELSKIPLLVNFSEPLSMLQRLTEDLEYHELLDQAARCENSLEQMCYVGAFIVSSYSTTVFRTNMPFSPLLGETFELDQTEESGFRSLCEQVNQHPPV
AAHHVDSRNGWTFHQEIEITGKFHGKFLDITPSGTVHCIFHATGHHYTWKKALTTVNNIILGKLWIDQSGEIEIANHKTGDKCILKFIPQSYLSQDVPRKITGQVIDPSK
KVHFALLGTWDEKVERFQVFPAKEYAREADPGVILWKRNPLPKNAENMYYFSEFALTLNALEDGVAPTDSRLRPDQRLMENGYWDEANAEKWRLEEKQRVSTKKREGRAA
RATDSGTSALHKALWFEQKEDPITRELVHMYRGGYWECKEKRNWALCPNIF*
6 >lcl|XP_001378512.1|Plus1complement(61133233..61137963) NW_001582021 sterile alpha motif domain containing 9-like SAMD9L __SEG__ Chr8 {Monodelphis domestica} MAEQTNLPENPDDWTVEDVCQWITEKLKINSKYTEILKKEEVNGKSLKVSDKNDLVDMGIKHGPALQIINSFKELNKSSECPKQTSEEQKDKQTEVQWVTQEKNRKRRRH
HTDPKNDTTTQDEEVYESPKTNPSKGTESNAEETKDNLPFRGQTCQTYPFDKFHKSFRYREQTIIQPETGSFNLIDPIHEFKALTNTERATEEDILMKFSNEVFRFASAC
MNCRTNGTIHFGVKDSPHGEIVGLKLTEEDKEKFVDHFYKKIEVYFEKDDVSQAKQCIRPPRFVEVLLKNNIVSDRFVIEIDIVPKHSICENKYFQVKMQIFKENKWGKN
AELSLYVRDGTSSKNIYANPKQKDGNIKAFLAELEKCVKLRKEAEDHQPKEIKTENEGTKLVHLLTGNQDLDNSYYDQYILVVNKSHPSQIEHLDFLKEIEWFAVLEFDP
ESLNTGVAKAYRETRAANLHFPNQYQDNKTSISEKIESFNLFKQTSWIFCNGRADFNTEEYQPLELSSWIKKRATKVRKLISFLTCEDVMQPGRFLVVFLLLSPVEDPKD
PFIETFSTFYQELGGMEDILSISVDQQIGSQWKELLEGKFSSIDLCNRCITTLSLEQLNGTILKLKPQTESPIRFLPSNGSSIILQKKDEDSMSALEILCENECKDTAIE
KDEKFTEFQMNKEKHFYLGGKVSWWNFYFYSENHTSDFIRRDSYEILEKMIQSLANSPRESGAEVINLYHHPGCGGTTLAMHILWELKKNFRCAVLKSKTFASEDIGAQV
RTLVTYGSEDQHSYMPVLLLVDDFEDQEAVSDLRNHIISALEEAYIQYETPLVIILNCMRSQNPEKDAKNPDSVAVINKLSSKEQRAFVKKFKEIEKKHENCRDFYSFMI
MKENFNRTYIQNVVKHILKGLNTDSKEGQLISFLSLLNSYISDSDFSVQQCEKFLEITNQRANWKRGSLENKMGNYSTILICTKAIDCKRYDRVRIVHPLIASCCLEELK
ITSEMKRSDIAVNLLKEDTLYSPGIRRDKFVRIVQTLLLKRQKEYSKETLISGKDMNTPFSPFLMDIKKDEGNDQVERVLTEGTIRFKDHALIYQALARHFYINENNFEA
AIFYAEEAKKRSVRNSFVSDTLGQVYKSQLIFCNNKISQGKSIPCQELEYLLNIAEKASNAFKDSQQYNENKDDKTGQYHRYKRSDTYNTSCYFGEIEVGIQIIQLLEKV
FLFDERNESPKGLMGQLLRGNSGVLLNPLIQRNMYYPVIKKHIDYLNALQKRLETIFNNLQDYFSFLKLKDNEKEIVEEKNQIKMEKLFKQYLSIFSNSEIRPSMVTSVC
WRELEISNAARFSGLLKYLTKTHENAEMEMESIVDRYMLLVQQASSMKTRAKQNFILANIILNCLKPNSKIRKPLDELKAMLQEVLLQVGLHSSYPDPYFLATLLFWPEN
QHLNQNSTEIIDYVTALRKTFWDQYGQMCRGKQPFTHFYLGNDRGLNRLVHRGKIEQCFQDASDVSILWQRGDVWREEKVKDLLLRLSGRVENDLIYIDCGSKENAEIPV
RPAVLGQLRRGQSMERVSFYLGFSTAGPVAYDIKNI*
7 >lcl|XP_001382104.1|Plus1complement(139437021..139437506) NW_001581841 uncharacterized protein C20orf79 homolog LOC100033253 __SEG__ Chr1 {Monodelphis domestica} MWKKERKRSHHQPKIKVSEGVSGTGQYVELNSGPDPSAPKSIQVTEIRSNLIFEEISRRVKEVGSQLVKKVNAIFQLDITKDGKTIVQWTVDLKNGSGEVYSGSARSPAD
TVFTIPDHIFMELVLGKTNPQRAFFAGKLKVSGKVMLGQKLEKIFKDCAKF*
8 >lcl|XP_003340169.1|Plus1complement(23574860..23575756) NW_001581868 phosphatidylinositol N-acetylglucosaminyltransferase subunit C-like LOC100020492 __SEG__ Chr2 {Monodelphis domestica} MSMCSAMANSRVVGWQKVLYERQPFPDNYVDQRFLEELRKNVSARKYQYWSVVFESGVVIQQLCSVCVFLVIWWYMDEGLLAPQWLFGTGLASSLVGYVLFDLIDGGTGR
KKSGRTRWADLKSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKK
LKACTPCSYVGVTLLFALSALVGLLTISGVGAILFALLLLSISCLCPYYLIRLQLFKENIHGPWDEAEIKEDLSRFLT*