SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab I    

ID / Description / Sequence
1 >lcl|XP_001490377.1|Plus1complement(6145407..6145862) NW_001867392 uncharacterized protein C20orf79-like LOC100050298 __SEG__ Chr22 {Equus caballus} MWKRTDHQPKIKAGDGPEDLGSAQEHATPHPLELSESQSFLVFEDISHHIKEMGAQLVKKVNAIFQLDITKDGKTILQWTIDLKNGAGDMYPGSARLPADTVFTIPEPVF
MELVLGKMNPQKAFLAGKFKVSGKVLLGQKLERVFKDWAKF*
2 >lcl|XP_001492447.3|Plus1complement(11040515..11045281) NW_001867413 sterile alpha motif domain-containing protein 9 SAMD9 __SEG__ Chr4 {Equus caballus} MAAQLNLPENTDDWTKEDVNRWLESHKIDQKHREILIAQDVSGAILKWLTKNNLIEMGITHGPAIQIENLFKELQKTSSEGSLQTNKKKKGSKNVPKTQTVMQEENGETS
KQKQKNKEKSDMANAPTMSTVTKDSKSLKNEFKVNEIDDTKEKQPSVELTCVSYPFDEFSDPYRYKLNFSLQPETGPLNLIDPIHEFKAFTNTERAREEDIKMKFSNEVF
RFASACMNSRTNGTIHFGVKDKPHGKIVGVKVSTVTKETLIDHFNLMIQQYFEDHQVQKAKKCIREPRFVEVLLPNSTPSDRFVIEVDVIPKYSECEDDYFRIKIQNCDN
NTWKQSSKFSIFVRDGASSKDIMKNNADFKEFKLDLKTLAEARKEAEEKYRLKTSKKENEGPKLVKLLTGNQDLLDNSYYDWYILVTNKCHPNQIKHLDFLKEIKWFAVL
EFDPESVSNGVVKAYKESRITNLHFPSLYMEGKTTSNEKITSLNLYQQPSWIFCNGRIDLDSEKYKPLDPSSWQREKASEVRKLISFLTHEDIMPRGKFLVVFLLLSSVD
DPRDPLIETFCAFYQDLKGMENILCICVHSHICQRWKDLLEARLTKQQDELSNQCISALSLEEINGTILKLKSVTQSLKRFLPSIGSSTVLLKKEEDIMTSLEILCENEC
EGTLLEKDKKKFLDFKTSKEEDFYRGGKVSWWNFYFSSKSYSLPFVKRDKYEILEEMIQNWADSSKPTCVKIIHLYHHPGCGGTTLAMHILWELRKKFRCAVLKNKTMDF
SEIGEQVATLITYGATNQQEYLPVLLLVDDFEEEDNVYLLQSSIQTAVANKYIRYEKPLVIILNCMRSQNPEKCAKNLDGIALIQNLSPKEQRAFEFKLKEIEEQHENFK
DFYSFMIMKTNFNEKYIENVVRNILKGQNISTKEAKLFSFLALLNSYVPDTTISLSQCENFLGITNKKAFWGVEKFEDKMGTYSTILIRTEVVECGKYCGVRIIHPLIAD
RSLEELRTSYHLDKSQIMLDMLTENLFYETGLGKSRFSEHIQTLLLTRQRNEHEGETGTLFSPFIEALHKDEGNVAVKEVLLEGIRRFNSNAFICQALARHFYLKEKDFS
SALKWANQAKKIEPHNSYISDTLGQVYKSKIRWWIEDNGKNRNISVDNLTDLLELAVEATNAFKESQQQSEDRQYEGKERFYQKSKRRYDTYNIAGYQGEIEAGLYTIQI
LQLIPFFDSKNELSKRDMINFISGSSDIPGDSSNEFKLALKNFIPYLTNLKCSLKRCFDFFDDYFVLLKPRNNIKQNEEARTRRKVAGHFKKYVDIFGPSVESQNKDLGA
KLSIPLQVELYRKSLEVLKADKFSGLLENLIKNQEDAIRTMDDIVNKYTFLFEQGTVKIQPKEKQNFILANIILYCIKPTSKIVKPIRKLKDQLREVLQQIGLTYRFSEP
YFLASLLFWPENQHLDQDSKQMEKYARSLENSFRGQYKHMYRTKQPIAYFFLGKGNNMTRLVHKGKIDQCFRNTSDINSLWQSGDVWKERNVQELLLRLKGRAENNCLYI
EYGVNDKITIPITPAFFGQLRSGRSIEKVSFYLGFSIGGPLAYDIEII*
3 >lcl|XP_001496774.2|Plus1complement(8365242..8366135) NW_001867416 phosphatidylinositol N-acetylglucosaminyltransferase subunit C-like LOC100060224 __SEG__ Chr5 {Equus caballus} MYAQPVTNTKEARWQKILYERQPFPDNYVDRRFLEELQKNIYARKYQYWAVVFESSVVVQQLCSVCVSWLSGGIWDEGLLAPHWLFGTGLASSLIGYVLFDLIDGGEGRK
KSRRTRWADLKSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKL
KACTPRSYVGVTLLFAFSALGGLLSISAVGAILFALLLLSISCLCPFYLIRLQLFKENIHGPWDEAEIKDDLSRFLS*
4 >lcl|XP_001500302.1|Plus1complement(32050797..32052413) NW_001867396 dolichol kinase-like LOC100070129 __SEG__ Chr25 {Equus caballus} MTRQCAPPASGTGAPLSGSVLAEAAVVFAVVLSIHAAVWDRYSWCAVALAVQAFYVQYKWDRLLQQGSAVFRFRTSANSGLLPASVVMPLLGLVMKERCQSAGNPYFERF
GIVVAASGMAVALFSSVLALGLTRPVPSNTCVISGLAGGVIIYIMKHSLSVGEVIEVLEVLLIFVYLNMILLYLLPRCFTPGEALLVLGGISFMLNQLIKRSLTVVESQG
DPVDFFLLVVVVGMVLMGVFFSTLFVFMDSGTWASSIFFHLMTCVLALGVVLPWLHRLIHRNPLLWLLQFLFQTNTRIYLLAYWTLLATLACQVVLYQNAKRSSSESKKH
QAPTIARKYFHFIVVATYVPGIVFDRSLLYVAATVCLAVFLFLEYVRYFRIKPLGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVP
YAGVLAVGVGDTVASIFGSTMGEIHWPGTKKTFEGTMTSIFAQIISVALILIFDSGVDLNYSYAWILGSISIMSLLEAYTTQIDNLLLPLYLLILLMA*
5 >lcl|XP_001500967.1|Plus135835318..35835761 NW_001867386 phospholipase A2-like LOC100071214 __SEG__ Chr1 {Equus caballus} MKLLVLAVLLTVGAGESGISPRAVWQFRSMIQCTIPNSKPYLEYNDYGCYCGLGGSGTSVDELDACCQVHDNCYTKAKELSSCRFLVDNPYTESYKFSCSGTEVTCSDKN
NACEAFICNCDRSAAICFSKAPYNLENKNLDSKRCKA*
6 >lcl|XP_001502227.1|Plus1complement(43400420..43400683) NW_001867366 diazepam-binding inhibitor-like 5-like LOC100072280 __SEG__ Chr11 {Equus caballus} MCQVEFELACAAIKQLKGPVSDQEKLLVYSFYKQATQGDCNIPAPPATDVKAKAKWDAWNDKKGISKMDAMRIYVAKVEELKKNDTG*
7 >lcl|XP_001503057.1|Plus139111964..39112776 NW_001867386 cholesterol 25-hydroxylase-like LOC100062138 __SEG__ Chr1 {Equus caballus} MSGHNSSELHVLCSSGQLFLQPLWDSLRTREALTHSPFFPVIFSIATYVGFCLPFVVLDLLCPWVPALRRYKIHPDFLPSARQVLPCLGQTLYQHLVFVFPATLLLWARG
PVFLPLEAPELLQLAFHVVFCLLLFDTEFFLWHVLHHKVPWLYRTFHKMHHQNSSSFALATQYMSIWELFSLVFFDIMNVTLLECHPLTILVFHVVNIWLSVEDHSGYDF
PWSTHRLVPFGWYGGVAHHDLHHSQFNCNFAPYFTHWDKILGTLRSAHAK*