SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam I    

ID / Description / Sequence
1 >lcl|XP_003433611.1|Plus1complement(22533458..22533856) NW_876284 fatty acid-binding protein, adipocyte-like LOC486632 __SEG__ Chr27 {Canis lupus familiaris} MCDAFVGTWKLSSSENFDDYMKEVGVGFATRKVAGMAKPSMIISVNGDVITIKSESTFKNTEISFKLGQEFDEVTADDRKVKSIITLDGGVLVRVQKWDGKSTTIKRKQV
DDKLVVECIMKGVTSTRIYERA*
2 >lcl|XP_003433923.1|Plus1complement(17757464..17758342) NW_876294 c-4 methylsterol oxidase-like LOC100685546 __SEG__ Chr30 {Canis lupus familiaris} MATNESISIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIATWGSLIVHEVLYFLFCLPGFLFQFIPFMKKYKIQKDKPETWENQWKCFKVLLFNHFCIQL
PLICGTYYFTEYFNIPYDWQRMPRWYMLLARCFGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPFGMEAEYAHPLETLILGTGFFIGIMLLCDVILLWALVTIHL
IGTIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGKYASTFTWWDRIFGTDSHFTAYNEKMKKIEKKMQ*
3 >lcl|XP_003435032.1|Plus124635835..24636728 NW_876323 phosphatidylinositol N-acetylglucosaminyltransferase subunit C isoform 1 PIGC __SEG__ Chr7 {Canis lupus familiaris} MCAQPVTDTKEIKWQKVLYERQPFPDNYVDRRFLEELRKNIYARKYQYWAVVFESSVVVQQLCSVCVFVVIWWYMDEGLLAPHWLFGTGLASSLIGYVLFDLIDGGEGRK
KSGRTRWADLKSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKL
KACTPCSYVGVTLLFAFSALGGLLSISAVGAILFAILLVSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS*
4 >lcl|XP_003435546.1|Plus134941273..34941614 NW_879562 fatty acid-binding protein, epidermal-like LOC100683046 __SEG__ ChrX {Canis lupus familiaris} MKEVGVGMALRKVGAVAKPDCIISSDDKNLTIKTESTLKTTQFSCNLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDEKESTITRKLEDGKLVVECVMNNVTCTRIYE
KVE*
5 >lcl|XP_537760.3|Plus1complement(26858760..26859023) NW_876332 diazepam-binding inhibitor-like 5-like LOC480641 __SEG__ Chr9 {Canis lupus familiaris} MCQVEFEMACAAIKQLKGPVSDQEKLLVYSFYKQATQGDCNIPAPPATDVKAKAKWEAWNQNKGMSKMDAMRIYVAKVEELKKKDTG*
6 >lcl|XP_537820.1|Plus16956230..6957840 NW_876333 dolichol kinase DOLK __SEG__ Chr9 {Canis lupus familiaris} MTREHAPPVPGAPLSGSVLAEAAVVFAVVLSIHAAVWDRYSWCAVALAVQAFYVQYKWDRLLQQGSAVFQFRMSANSGLLPASMVMPLFGLVMKERCQSMGNPYFERFGI
VVAATGMAVALFSSVLALGITRPVPTNTCVISGLAGGVIIYIMKHSLSVGEVIEVLEVLLIFVYLNMILLYLLPRCFTPGEALLVLGGISFMLNQLIKRSLTVVESQGDP
VDFFLLVVVVGMVLMGVFFSTLFVFMDSGTWASSIFFHLMTCVLGLGVVLPWLHRLIRKNPLLWLLQFLFQKETRIYLLVYWSLLATLACLVVLYQNAKRSSSESKKHQA
PTIARKYFHFIVVATYIPGIILDRTLLYVAATICLTVFIFLEYVRYFRIKPLGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGNLGGARALVPYA
GVLSVGVGDTVASIFGSTMGEIHWPGTKKTFEGTMTSIFAQIISVALILIFDSGVDLNYSYVWILGSISIVSLLEAYTTQIDNLLLPLYLLILLMA*
7 >lcl|XP_542873.3|Plus1complement(4399671..4400141) NW_876277 uncharacterized protein C20orf79 homolog LOC485750 __SEG__ Chr24 {Canis lupus familiaris} MWKRIDHQHKIKAGDGPQAGQFKELGAAREPAVPHPLELSEFQSFPVFEDISHHIKEVGAQLVKKVNAIFQLDITKDGKIILQWTIDLKNGSGDMYPGSARLPADTVFTI
PEPVFMELVLGKMNPQKAFLAGKFKVSGKVLLGQKLERVFKDWAKF*
8 >lcl|XP_543596.1|Plus1complement(12767473..12768285) NW_876283 cholesterol 25-hydroxylase CH25H __SEG__ Chr26 {Canis lupus familiaris} MSSHNSSGPLALGPPGQLLLQPLWDQVRARAALAQSPPFAVLFSITAYLGCCLPFVLLDLLCPRVRALRRYKVHPDCGPSARQLLGCLGRTVCQHVALLLPASLLHCARG
PAPWPREAPELLQLARHVLGCLLLFDAEVFAWHVLHHRVPWLYRTFHKLHHQHAASFALATQYMGAWELLSLGFFHVLNVVLLQCHPLSVLAFHLLNIWLSVEDHSGYDF
PWSTHRLVPFGWYGGVAHHDLHHSQFNCNFAPYFTHWDRILGTLRSAPAK*
9 >lcl|XP_548843.3|Plus12296519..2296917 NW_879562 fatty acid-binding protein, adipocyte-like LOC491723 __SEG__ ChrX {Canis lupus familiaris} MCDAFVGTWKLSSSENFDDYMKEVGVGFATRKVAGMAKPNRIISVNGDVITIKSESTFKNTEISFKLGQEFDEVTADYRNVKSIITLDGGVLVQVQKWDGESTTIKRKQV
DDKLVVECIRKGVTSTRIYERA*
10 >lcl|XP_853729.1|Plus1complement(29347791..29348477) NW_876327 3-beta-hydroxysteroid-Delta(8), Delta(7)-isomerase-like LOC611024 __SEG__ Chr8 {Canis lupus familiaris} MTTNASPLHPYWPRQLRLDNFVPNDCPTWHLLAGLFSVSGVLVVTTWLLSGRAAVILLGTWQRLSLCWFAVCGFIHMVIEGWFSLYHKDLLGDQAFLSQLWKEYAKGDSR
YILSDNFTICTETITACLWRPLSLWVVIAFLLQQPLRFVLQLMVSVGQIYGDVLYFLTEHRDGFQHGELGHPLYFWFYCVFMNSLWLVLPGILVLDSVKQLAHAQSVLDA
KGTKAKSK*