SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau I    

ID / Description / Sequence
1 >lcl|NP_001029555.1|Plus1complement(922657..923550) NW_001493415 phosphatidylinositol N-acetylglucosaminyltransferase subunit C PIGC __SEG__ Chr16 {Bos taurus} MCAQPVANTKEVRWQKVLYERQPFPDNYVDRRFLEELRKNIYARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPQWLFGTGLASSLIGYVLFDFIDGGEGRK
KSGRTRWADLKSALVFITFTYGFSPVLKTLTESVSTDTIYAMAVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKL
KACTPRSYVGVTLLFAFSALGGLLSISAVGAILFALLLISISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS*
2 >lcl|NP_001030442.2|Plus1complement(546150..547766) NW_001492998 dolichol kinase DOLK __SEG__ Chr11 {Bos taurus} MTRECAPPTPGSGAPLSGSVLAEAAVVFVVVLSIHAAVWDRYSWCAVALAVQAFYVQYKWDRLLQQGSAVFQFRMSANSGLLPASVVMPLLGLVMKERCQAAGNPYFERF
GIVVAATGMAVALFSSVLALGITRPVPTNTCVISGLAGGVIIYIMKHSLSVGEVIEVLEALLIFVYLNMILLYLLPRCFTPGEALLVLGGISFMLNQLIKRSLTVVESQG
DPLDFFLLVVVVGMVLMGIFFSTLFVFMDSGTWASSIFFHLMTCVLGLGVVLPWLHRLIRRNPLLWLFQFLFQTETRVYLLAYWCLLATVACLVVLYQNAKRSSSESKKH
QAPTITRKYFHFIVVATYIPGIILDRPLLYVAATVCLAVFIFLEYVRYFRIKPLGHTLRSLLSLFLDERDSGPLILTHIYLLLGMSLPIWLVPRPCTQKGSLGGARALVP
YAGVLAVGVGDTVASIFGSTMGEIRWPGTKKTFEGTMTSIFAQIISVALILIFDSGVDLNYSYAWILGSISTVSLLEAYTTQIDNLLLPLYLLILLMA*
3 >lcl|NP_001035597.1|Plus14277320..4277790 NW_001493123 hypothetical protein LOC505971 C13H20orf79 __SEG__ Chr13 {Bos taurus} MWKRIDHQLKIKAGDGPQAGQFKELGPGREPAVPHPLSLSEFQTVPVFEDISQHVKEVGSQLVKKVNAIFQLDITKDGKTVHQWTIDLKNGSGDTYRGPARLPADTVFTI
PEPVFMELILGKMNPQKAFLAGKFKVSGKVLLGQKLERVFKDWAKW*
4 >lcl|NP_001068711.1|Plus1complement(438879..439691) NW_001494351 cholesterol 25-hydroxylase CH25H __SEG__ Chr26 {Bos taurus} MNSHNRSELHVLCSSGQLFLQPLWDRLRTWDALIQSPFFPVVFSITTYVGFCLPFVVLDVLCPWVPTLRRYKIHPDFSPSARQLLPCLGQTLYQHVVFVFPMTLLHWAVS
PALLPAEAPELFQLVSHVALCLLLFDTEFFVWHLLHHKVPWLYRTFHKMHHQNSSPFALSTQYMSVGELFSLGVFDMVNVLLLQCHPLTSLTFHVVNIWLSVEDHSGYDF
PWSTHRLVPFGWFGGVAHHDLHHSQFNCNFAPYFTHWDKILGTLRSAHAK*
5 >lcl|NP_001095607.1|Plus13241862..3242170 NW_001494990 acyl-CoA synthetase short-chain family member 3, mitochondrial precursor ACSS3 __SEG__ Chr5 {Bos taurus} MKPSWLQCRKVTGAGGLGGSLPASSPARGAGPARRAYVAPGPRGALGGRGCRALSSGGGEYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENRHSPSTSW
6 >lcl|NP_001096737.1|Plus1complement(648676..650289) NW_001495250 prosaposin-like 1 PSAPL1 __SEG__ Chr6 {Bos taurus} MLCALLLLPGVLCAALAGSISGPKECAKGPAVWCRDLQAATRCGAVGHCRVAIWSQPTARSLPCDLCLDVAATASNGLNPKAAETDVLAAVMKTCEWLPSQESLVKCKGM
VDAHGSAILSMLGGDLGSAPGQVCMALTLCQPLQRHPATPGPLSEEDIYDVVAPFVANGLLSSRRQRIAVGTVCQDCVRLVTRLQGALGPDLSSLAQVTTREQCESLGPG
LAFLCKNYIHQFFAPAEQTLRFMLPSEICRKEGFCEEWQGPPDSAHMAAVDGVPALELASPWRKGEVQMQGPVACDVCLQVVQRLDHWLESSSSKTIISQALERVCSVLP
PPVVRECIKLVDTYVPTVVDVLSRLTPEKMCTVIRLCRGWRRARAVHEGPTNPPPGLLDKDSLCRGCQQLFGVSVHNLEQKTTERRVLRAFKLACGILPLPFVMQCGRFV
SEYQPVLMMTLRDMMDPPTLCTKLRACRDPRDTLLGTDQCVLGPSFWCQSREAAQMCNMVEHCQRRVWKEAPSPAESAGDRGCPSQDPPPLERPASP*
7 >lcl|NP_803460.1|Plus1complement(202773..202895) NW_001494862 carnitine O-octanoyltransferase CROT __SEG__ Chr4 {Bos taurus} MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESGMF
8 >lcl|NP_847892.1|Plus1complement(457805..458068) NW_001493662 diazepam-binding inhibitor-like 5 ELP2P __SEG__ Chr19 {Bos taurus} MCQVEFEMACAAIKQLKGPVSDQEKLLVYSYYKQATQGDCNIPAPPATDLKAKAKWEAWNENKGMSKMDAMRIYIAKVEELKKNEAG*
9 >lcl|XP_001250262.1|Plus1complement(348952..349809) NW_001494722 Steroidogenic acute regulatory protein, mitochondrial-like STAR __SEG__ Chr3 {Bos taurus} MLLATFKLCAGSSYRHVRSMKGLQQQAVLAIGQELNRRALGGPAPAAWINQVRRRGSLLGSQLEDPLYSNQELAYIQQGEEAMQRALGILKDQEGWKKESRQANGDEVLS
KVIPDVGKVFRLEVVVHQPMERLYEELVERMEAMGEWNPNVKEIKVLQKIGKDTVITHELAAEAAGNLVGPRDFVSVGCTKRRGSMCVLAGMATLYEEMPQQKGVIRAEH
GPTCMVLRPLAGSPSRTKLTWLLSIDLKGWLPKTIINQVLSQTQVDFANHLRKRLESCPALEARC*
10 >lcl|XP_001253214.2|Plus1complement(3353465..3353971) NW_003101170 tafazzin-like LOC785078 __SEG__ Chr5 {Bos taurus} MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTKCMNHLTVHNKEVLYDLIENRGPATPLITVSNHQSCMDDPHLWGILKLRHIWNLKLMRWTPTAADICFTKELHP
HFFSLGKCVPVCRGDGVYQKGMDFILEKLIKKKKKIPKGSWTAFILTQNDERIGHNII*
11 >lcl|XP_589404.2|Plus1complement(1599015..1599545) NW_001495428 low density lipoprotein receptor-related protein associated protein 1-like LOC511975 __SEG__ Chr8 {Bos taurus} MKEESVEKGRVGKALEESHENAIRPVDLSGVQTEALASRHAELKDRLRSIGQGFDWLRRVSHQGYGAETEFTEPRVLDPWDMAKSANFTEKELESFREELKHFEVKIEKH
NHYQKQLEISHRKLKHVESFGDQEHVTRNKERYAMLEEKTKELGYKVKKHMQDLSSRISRARHNEL*
12 >lcl|XP_592046.2|Plus1complement(1753742..1754149) NW_001494805 retinol binding protein 1, cellular-like LOC514233 __SEG__ Chr3 {Bos taurus} MPVDFTGYWKMLANENFEEYLRVLDVNVALRKIANLLKPDKEIVQEGDHMIIRMLSTFRNYIVDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLECVQKGEKEGHGWTQW
IEGEELHLEMRMEGVVCKQVFKKVN*
13 >lcl|XP_869356.1|Plus1598099..598806 NW_001493902 MLN64 N-terminal homolog isoform 2 LOC508623 __SEG__ Chr1 {Bos taurus} MNPLPEDMENMLMGSQSSHASVHDVHSINPTQLMARIESYEGREKKGISDVRRTFCLFVTFDLLFVTSLWIIELNVNGGIENTLEKEVVQYDYYSSYFDIFLLAVFRFKV
LILAYAVCRLRHWWDIALTTAVTSAFLLAKVILSKLFSQGAFGYVLPIISFILAWIETWFLNFKVLPQEAEEENRLLIVQDASERVALIPGGLSDGQFYSPPESEAGSEN
EAEEKQDSEKPPLGL*