SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr H    

ID / Description / Sequence
1 >lcl|NP_001095289.1|Plus1783729..785096 NW_003536671 adenylyltransferase and sulfurtransferase MOCS3 MOCS3 __SEG__ Chr17 {Sus scrofa} MAAREEVLALQAEVARREEELSSLKHRLAAALLAEQESERLLPVSPLPPKAALSQDEILRYSRQLVLPELGVQGQLRLATASVLIVGCGGLGCPLAQYLAAAGVGRLGLV
DYDVVEVSNLARQVLHGEALAGQAKVFSAAASLRRLNSAVECVPYAQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYGGGPC
YRCVFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGLFRRIQLRRRRPDCAACGERPTVTELQDYEGFCGSSATDKCRSLQLLSP
EERVSVIDYKRLLDSGSPHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLGEAIREGKQGTQEGASLPIYVICKLGNDSQKAVKILQSLPDLDSLLVQDVVGG
LMAWAAKVDGTFPQY*
2 >lcl|NP_001161125.1|Plus165052..>65330 NW_003533956 decaprenyl-diphosphate synthase subunit 2 PDSS2 __SEG__ Chr1 {Sus scrofa} MSLRQLLKRLPYFGASGPPRRPLDTISSVVSWRGQSSRSPAHWNQVVSEAEKIVGYPTSFMSLRCLLSDELSNIAMQVRKLVGTQHPLLTTAR
3 >lcl|XP_001925822.2|Plus1complement(1222191..1222403) NW_003535196 5-formyltetrahydrofolate cyclo-ligase-like LOC100152422 __SEG__ Chr7 {Sus scrofa} MPGLGFDNCGNRLGRGKGYYDAYLKRCLQSQDVKPYTLALAFKEQICLQVPMDEHDMKVDEVLYEDSPAS*
4 >lcl|XP_003355610.1|Plus1complement(74697..75926) NW_003534797 LOW QUALITY PROTEIN: adenosylhomocysteinase RECQL __SEG__ Chr5 {Sus scrofa} MACLRMQGPGLTENEMLGLKLMQEMYLASKPLKGTFIASYLHMTILTEPLIALGTVVQLQHFLYPESCSSCRYQGWHSNIPLEG*NGGRISVVNLVDTVLQGLAPQHDSG
*WW*PYQPCPHQVPTGYVSHPGHL*RDHDGSLQSVQGVMASGILKVPAINIDNSITKSKSDNIYGCWESLIDGIKQATDVMIARW*W*WAMEM*ARTTPRTCGVLGLGHH
HRGQPHQSISGCHRGL*GDHHG*GLSGEQHLCHHPGCTDIILSQHFEQMKDDTIICNVGYFDVEIDVKWLNENAVEKVNIKPQVDRYLLKNGHRIILLDEGSRVNLGCSI
GHPSFMMSNSSTDQVLVQIELWTHPYKYPLRVCFLHKKLDQTVAEAHQGKLNMKLTKLNEKQTQQAHPRRAPSSLIITTT