SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor H    

ID / Description / Sequence
1 >lcl|NP_001101274.1|Plus16000536..6001912 NW_047660 molybdenum cofactor synthesis 3 Mocs3 __SEG__ Chr3 {Rattus norvegicus} MAAPEDVAALQDEIARREEELASLKQRLAAALAVEPEPERPIPVMPLPSRAALSRDEILRYSRQLLLPELGVRGQLRLAAASVLVVGCGGLGCPLAQYLAAAGVGRLGLV
DHDVVETSNLARQVLHGEAQAGHAKAWSAAAALRRLNSAVEYVPYARALSEAWALDLVRGYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQMTVYHYDDGPC
YRCVFPRPPPAETVTNCADGGVLGVVPGVLGCVQALEVLKIAAGLGTTYSGSMLLFDGLGGHFRRIRLRRRRPDCVVCGQQPTVTCLKNYEAFCGSSATDKCRSLKLLSP
EERISVTDYKRLLDSGVPHVLLDVRPQVEVDICRLQHSLHIPLSLLERRDADSLKLLGAALQEEKRNSQEGAALAVYVICKLGNDSQKAVRVLQSLTAVPELDSLKVQDI
SGGLMAWAAKIDGTFPQY*
2 >lcl|NP_001101682.1|Plus12937350..2938465 NW_047814 lipoyltransferase 1 Lipt1 __SEG__ Chr9 {Rattus norvegicus} MLIPFSVKNCFRLLCQHKVPTAGFKSPPTHGLILQSISNDVYENLAVEDWIHDHIHLEGKPILFLWRNSPSVVIGRHQNPWQECNLHLMRQEGIKLARRKSGGGTVYHDM
GNINLTFFTTKTKYDRMENLKLIVRALNAVQPQLDVQPTKKFDLLLDGQFKISGTASKIGRTAAYHHCTLLCSTDRTALSSSLKSPYHGIKSNATPSIPSTVKNLLERDS
TLTCDVLMSAVAAEYAAYHQIDDHVNLINPADETVFPGINSKIKELQSWEWVYGRTPRFTVDTMFHVPHGQACLEIQVFMDVKNGRIETCDIKAPDHWLPLEIGDKLNSS
FIGSKFCPVETTLLTNILLRTDDHHLQSKLNILCEKIRGMM*
3 >lcl|XP_227370.2|Plus1complement(12902494..12902976) NW_047626 farnesyl pyrophosphate synthetase-like RGD1560208 __SEG__ Chr2 {Rattus norvegicus} MFKIESCTAFYSFYLPIAAAMYMAGFDREKEHANALKILLEMGKFFQIQDDYLDLFGDPSVTGKVDTDIQDNKCSWPVVQCLLRATSQQHQKVEENYGQKDPEKVAQVKA
LYEALDLQNVFFKYEEDSYNHLKSLIEQCSVPLSPSIFLELAKKIYKWRK*
4 >lcl|XP_230344.5|Plus1complement(26746998..26747465) NW_047657 riboflavin kinase-like RGD1560961 __SEG__ Chr3 {Rattus norvegicus} MRSLPFFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADVSTGIYYGWASVGSGEVHKMVVSIGWNPYYKNVKKSMQTHIIHTFKEDFYGEILNVAIVGYLRPEKNFD
SLESLISAIQGDIEEAKKQLDLPEHLKLKDDNFSQVFKSKIMNGH*
5 >lcl|XP_233236.1|Plus19430578..9431627 NW_047717 methylenetetrahydrofolate dehydrogenase 2 RGD1564040 __SEG__ Chr5 {Rattus norvegicus} MASVSLSALAVRLLCLTHGCHSRLQSFHLVAVRNEAVVISGRKLAQQIKQEVWQEVEEWVASGNKRPHLTVILVGDNPASHSYVLNKTRAAAKVGINSESIVKPASVSEE
ELLNSIRTWNDDENVDGLLVQLPLPKHIDERKICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEILKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHER
PGGDATVTISHRHTPKEQLKKHRILADIVISAAGIPNLITADMIKEGATVIDVGINRVQDPVTAKPKLVGDVDFEGVKKKAGYITPVPRGVGPMTVAMLMKNTIIAAKKV
LRPEELEVLKSTQHGVATN*
6 >lcl|XP_577001.1|Plus18142924..8143391 NW_048043 similar to riboflavin kinase isoform 2 RGD1563242 __SEG__ ChrX {Rattus norvegicus} MRSLPFFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADVSTGIYYGWASVGSGEVHKMVVSIGWNPYYKNVKKSMETHIIHTFKEDFYGEILNVAIVGYLRPEKNFD
SLESLISAIQGDIEEAKKQLDLPEHLKLKDDNFFQVSKSKIMNGH*
7 >lcl|XP_577020.2|Plus1723520..725190 NW_048044 spermine oxidase-like RGD1564480 __SEG__ ChrX {Rattus norvegicus} MQSCESSGDSADDPLSRGLRRRRGQPRVVVIGAGLAGLAAARALLEQGFTDVTVLEASSHIGGRVQSVKLGHATFELGATWIHGSHGNPIYQLAEANGLLEETTDGERSV
GRISLYSKNGVACYLTNRGRRIPKDVVEEFSDLYNEVYNLTQEFFRNGKPVNAESQNSVGVFTREKVRNRIRDDPDDTEATKRLKLAMIQQYLKVESCESGSHSIDEVSL
SAFGEWTEIPGAHHIIPSGFMRVVELLAQGIPPHVIQLGKPVRCIHWDQASARPWGPEIEPHGEGDHNHDAGEGGQSGENPQQGRWDEDEQWPVVVEFEDCEVIPADHVI
VTVSLGVLKRQYTSFFRPCLPTEKVAAIHRLGIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESCTLTYPPELWYRKICGFDVLYPPERYGHVLSGWICGEEALVMERC
DDETVAEICTEMLRQFTGNPNIPKPRRILRSAWGSNPYFRGSYSYTQVGSSGADVEKLAKPLPYTESSKTAPMQVLFSGEATHRKYYSTTHGALLSGQREATRLIEMYRD
LFQQGP*