SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ptro H    

ID / Description / Sequence
1 >lcl|XP_001138432.1|Plus1complement(505462..506022) NW_003456884 dihydrofolate reductase-like 1 isoform 2 DHFRL1 __SEG__ Chr3 {Pan troglodytes} MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLNDRINLVLSRELKEPPQGAHFFARSLDDALKLTERPELANKV
DMIWIVGGSSVYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVYEND*
2 >lcl|XP_003308467.1|Plus12735664..2736548 NW_003456632 FAD synthase isoform 2 FLAD1 __SEG__ Chr1 {Pan troglodytes} MQPSSSAPPLHPYSTDGLIFPFNPQGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIGPTHDDVTFEAVAQAFGDELKPHPKLEAAT
KALGGEGWEKLSLVPSSARLHYGTDPCTGQPFRFPLVSVRNVYLFPGIPELLRRVLEGMKGLFQNPAVQFHSKELYVAADEASIAPILAEAQAHFGRRLGLGSYPDWGSN
YYQVKLTLDSEEEGPLEECLAYLTARLPQGSLVPYMPNAVEQASEAVYKLAESGRDLMEEVHYAQSHWWHPRSQ*
3 >lcl|XP_003308877.1|Plus1266474..267214 NW_003456664 geranylgeranyl pyrophosphate synthase-like isoform 4 LOC100610192 __SEG__ Chr1 {Pan troglodytes} MLHNASLLIDDIEDNSKLRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLTLDHPDAVKLFTRQLLELHQGQGLDIYWRDNYTCPTEEEYKAMVLQKTGGLFGLAVGLMQ
LFSDYKEDLKPLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQ
IDARGGNPELVALVKHLSKMFKEENE*
4 >lcl|XP_003339069.1|Plus11580808..1581929 NW_003456754 lipoyltransferase 1, mitochondrial LIPT1 __SEG__ Chr2A {Pan troglodytes} MLIPFSMKNCFQLLCNCQVPAAGFKKTVKNGLILQSVSNDVYQNLAVEDWIHDHMNLEGKPILFFWRNSPSVVIGRHQNPWQECNLNLMRGEGIKLARRRSGGGTVYHDM
GNINLTFFTTKKKYDRMENLKLIVRALNAVQPQLDVQATKRFDLLLDGQFKISGTASKIGRTTAYHHCTLLCSTDGTFLSSLLKSPYQGIRSNATASIPSLVKNLLEKDP
TLTCEVLMNAVATEYAAYHQIDNHIHLINPMDETLFPGINSKAKELQTWEWIYGKTPKFSINTSFHVLYEQSHLEIKVFIDIKNGRIEICNIEAPDHWLPLEIRDKLNSS
LIGSKFCPTETTMLTNILLRTCPQDHKLNSKWNILCEKIKGIM*
5 >lcl|XP_514724.2|Plus12162326..2163708 NW_003458557 adenylyltransferase and sulfurtransferase MOCS3 MOCS3 __SEG__ Chr20 {Pan troglodytes} MASREEILALQAEVAQREEELNSLKQKLASALLAEQAPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLG
LVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGG
PCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLL
SPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVR
DVVGGLMAWAAKIDGTFPQY*