SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus H    

ID / Description / Sequence
1 >lcl|NP_001033007.2|Plus115458361..15459482 NT_039170 lipoyltransferase 1, mitochondrial precursor Lipt1 __SEG__ Chr1 {Mus musculus} MLIPLSMKNCFRLLCQHKVPAAGFKSPPTHGLILQSISNDVYENLAFEDWIHDHIHLEGKPILFLWRNSPSVVIGRHQNPWQECNLHLMRQEGIKLARRKSGGGAVYHDM
GNINLTFFTTKTKYDRMENLKLIVRALNAVQPQLDVQPTKKFDLLLDGQFKISGTASKIGRTAAYHHCTLLCSTNRTALSSSLKSPYCGIKSNATPSIPSAVKNLLERDS
TLTCEVLMSAVAAEYAAHHQVDGHVNLINPADETMFPGINRKVKELQSWEWVYGRTPKFTVDTTFHVPYEQAHLEIQVFMDVKNGRIETCAIKAPDHWLPLEIGEKLNSS
FIGSKFCPVETTLLTNVLLRTCPGDHHLHSKWYILCEKIRGIM*
2 >lcl|NP_001153802.1|Plus1109097437..109098819 NT_039207 adenylyltransferase and sulfurtransferase MOCS3 Mocs3 __SEG__ Chr2 {Mus musculus} MAAPEDVAALQAEITRREEELASLKRRLAAALTAEPEPERPLRVPPPPLAPRAALSRDEILRYSRQLLLPELGVRGQLRLAAAAVLVVGCGGLGCPLAQYLAAAGVGRLG
LVDHDVVETSNLARQVLHGEAQAGESKARSAAAALRRLNSAVECVAYPRALAEDWALDLVRGYDVVADCCDNVPTRYLVNDACVLAGRPLVSASALRFEGQMTVYHHDGG
PCYRCVFPRPPPPETVTNCADGGVLGAVPGVLGCAQALEVLKIAAGLGSSYSGSMLLFDGLGGHFRRIRLRRRRPDCVVCGQQPTVTRLQDYEAFCGSSATDKCRALKLL
CPEERISVTDYKRLLDSGAPHVLLDVRPQVEVDICRLPHSLHIPLSQLERRDADSLKLLGAALRKGKQESQEGVALPVYVICKLGNDSQKAVKVLQSLTAVPELDSLTVQ
DIVGGLMAWAAKIDGTFPQY*