SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmul H    

ID / Description / Sequence
1 >lcl|XP_001089745.1|Plus1complement(5398851..5400149) NW_001112572 adenosylhomocysteinase AHCY __SEG__ Chr2 {Macaca mulatta} MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMREQYLASKPLKGAPIAGCLHMTVETAILIETLIALGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGEMDEEY
LWCIEQTLYFKDGPLNMILDDGGDLTNLIHTKYPQLLSGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAG
YGNVGKGCAQALRGFGACVIITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCVDIILGWHFEQMKDNAIVCNIGHFDVEIDVKWLNENVVEKVNIKPQMDRYRL
KNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSRDGPFKPDHNRY*
2 >lcl|XP_001093903.1|Plus1complement(796955..798343) NW_001095132 adenylyltransferase and sulfurtransferase MOCS3 MOCS3 __SEG__ Chr10 {Macaca mulatta} MASREEVLALQAEVSQREEELNSLKQKLASALLAEQEPRPERLVPVSPLPPKATLSPDEILRYSRQLVLPELGVHGQLRLATASVLVVGCGGLGCPLAQYLAAAGVGRLG
LVDYDVVEMSNLARQVLHGEALAGQAKALSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLINDACVLAGRPLVSASALRFEGQITVYHYDGG
PCYRCIFPQPPPAETVTNCADGGVFGVVTGILGCLQALEVLKITAGLGPSYSGSLLLFDALRGHFRCIRLRSRRLDCAVCGERPTVTDLLDYEAFCGSSATDKCRSLQLL
SPEERISVTDYKRVLDSGASHLLLDVRPQVEVDICRLPHALHIPLKHLERRDGESLKLLKEAIWEGKQGTQEEAAVPIYVICKLGNDSQKAVKVLQSLAAAQELDSLTVR
DVVGGLMAWAAKIDGTFPAVLR*
3 >lcl|XP_001103668.1|Plus11853769..1854890 NW_001099013 lipoyltransferase 1, mitochondrial-like isoform 3 LIPT1 __SEG__ Chr13 {Macaca mulatta} MLIPFSMKNCFQLLCNHQVPAAGFKQTVKNGLILQSVSNDVYQNLAVEDWIHDHMNLEGKPILFFWRNSPSVVIGRHQNPWQECNLNLMREEGIKLARRRSGGGTVYHDM
GNINLTFFTTKKKYDRMENLKLILRALNAVQPQLDVQATKRFDLLLDGQFKISGTASKIGRTTAYHHCTLLCSTDGTFLSSLLKSPYQGIRSNATASIPSLVKNLLEKDP
TLTCEVLMNAVATEYAAYHQIDHHIHLINPTDETLFPGINSKAKELQTWEWIYGKTPKFSINTSFHVLYEQSHLEIKVFLDIKNGRIEICNIEAPDHWLPLEIRDKLNSS
LIGSKFCPTETTMLTNILLRTCPQDHKLHSKWNILCEKIKGIM*