SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom H    

ID / Description / Sequence
1 >lcl|XP_001363558.1|Plus115183823..15184941 NW_001581989 lipoyltransferase 1, mitochondrial-like LOC100012537 __SEG__ Chr7 {Monodelphis domestica} MLIPFSMKNCFQSLYSLKIPTAGYKNIAKGGLILQSASNNIYQNLAVEDWIHDHMNLESKPILFLWRNSPTVVIGRHQNPWQECNLNIMREKGIKLARRRSGGGTVYHDM
GNINLTFFTIKSKYNRMENLKLIIRALNAVQPQLDVQATDRLDLLLDGQFKISGTASKIGRVAAYHHCTLLCNTDWISLSSVLKSPYQGIKSNATPSVPSLVKNLLENDD
TLTCEVLMESVAAEYAAYHKIENNIILISPTDETVFPGINKKAEELQTWEWIYGKTPKFSINTSFNLSEQSYSEIKVYADIKNGRIEDCKIDAPDHSLPLEMLDKLSTSF
IGNKFCQSETSVLINALLRTCPKDYELNTKWHLLCQKVKSIM*
2 >lcl|XP_001369247.1|Plus1complement(30142467..30143837) NW_001581841 adenylyltransferase and sulfurtransferase MOCS3-like LOC100022807 __SEG__ Chr1 {Monodelphis domestica} MAANKEVLALQAEVALREEELRLLKQRLEAATAEPFSLQPCEPAPLPPKTSLSREEILRYSRQLVLPELGVRGQLRLAASSVLVVGCGGLGCPLAQYLAAAGVGRLGLVD
HDVVELSNLHRQVLHGEGRAGQAKAHSAAAALGRLNSAVQCVPYAEALTPATALDLVRRYDVVADCSDNVPTRYLVSDACVLAGRPLVSASALRLEGQLTVYHYEDGPCY
RCVFPTPPPAETVTNCADGGVLGVVPGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALTGQFRRIQLRGRRSDCVVCGDHPTVTHLQDYEAFCGSSATDKCRSLQLLSQE
ERVSAAHYKQVLDSGEPHLLLDVRPKVEVDICCLPHALHIPLSHLEHRDVESLELLGDAIRKGKQNIKKGMLFPIYVICKLGNDSQKAVKVLQGLSVKELDSLLARDISG
GLMAWATKIDPSFPQY*
3 >lcl|XP_001370929.1|Plus17571641..7572387 NW_001581928 thiamin pyrophosphokinase 1-like LOC100017344 __SEG__ Chr4 {Monodelphis domestica} MEHVLSPLECLLPTGDLKYCLLILNQPLDRRPLHHLWSKALLRACADGGSNHLYDITEGQRESFLPEYISGDFDSIRPEVKEYYQVKGCELVETPDQNDTDFTKCLHVLQ
KKIVDKDLQVDMIVALGGLAGQVDQIMASVETLFHATAITPVPVIIIQADSLICLLQSGKHQLHVDTGLEGEWCGLVPVGQSCKQVTTTGLKWNLTKDVLMFGTLVSTSN
TYDGSGVVTVETDHPLLWTMAIKKEPRE*