SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab H    

ID / Description / Sequence
1 >lcl|XP_001490521.1|Plus1complement(6817147..6818268) NW_001867379 lipoyltransferase 1, mitochondrial LIPT1 __SEG__ Chr15 {Equus caballus} MLIPFSTKNCFRLLCNLKVPAAGFKNIVKSGLILQSISNDVYQNLAVEDWIHDHMNLEGKPVLFLWRNSPSVVIGRHQNPWQECNLNLMREEGIKLARRRSGGGTVYHDM
GNINLTFFTTKKKYDRMENLKLVVRALNSVQPQLDVQPTKRFDLLLDGQFKISGTASKIGRTTAYHHCTLLCGTDRTFLSSLLKSPYQGIRSNATASIPALVKNLLEKDP
TLTCEVLMNAIAAEYAAYHQIDNHISLINPTDETLFPGINSKAKELKTWEWIYGKTPKFSINTSFNVLYEQSHLEIKVFIDIKNGRIEICNIEAPDHWLPMEICDKLNSS
FIGSKFCPIETSMLINILHRTCPEDDEVHSKWNILCEKIKGIM*