SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam H    

ID / Description / Sequence
1 >lcl|XP_003431574.1|Plus1complement(27110173..27111294) NW_876251 lipoyltransferase 1, mitochondrial LIPT1 __SEG__ Chr10 {Canis lupus familiaris} MLIPFSMKNCFQLLCNLKVPTSGFKNQVKSGFILQSISNDVYQNLAVEDWIHDHMNLEGKPVLFLWRNSPSVVIGRHQNPWQECNLNLMREEGIKLARRRSGGGAVYHDM
GNINLTFFTTKKKYDRMQNLKLVVRALNAVQPQLDVQATKRCDILLDGQFKISGTASKIGRTTAYHHCTLLCSTNRTFLSSSLKSPYQGIRSNATTSIPSIVKNLLEKDP
TLTCEVLMNAVAAEYAAYHQIDNHINLINPTDETLFPGINNKAKELQTWEWIYGKTPKFSINTSFNVLDEQSHLEIKIFIDIKNGRIETCNIEAPDHWLPLEICDKLNSS
FIGSKFCPIETTMLTNLLLRTCPGDNELHSKWNILCEKIKGIM*
2 >lcl|XP_003432528.1|Plus116737653..16738228 NW_876267 dihydrofolate reductase DHFR __SEG__ Chr19 {Canis lupus familiaris} MGPQPWCTLNCIVAVSQNLGIGRNGDLPWPPLRNEFKCFQRMTTNSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRDLKEPPQGAHFLAKSLDDALKLTEQPEL
ANKVDMVWIVGGSSVYKEAMNKPGHLRLFVTRIMHEFEGDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND*
3 >lcl|XP_003434042.1|Plus122142780..22143529 NW_876295 geranylgeranyl pyrophosphate synthase-like LOC100686075 __SEG__ Chr31 {Canis lupus familiaris} MEMTQETVQRVLLEPYKYLLQLSGKQVRTKLSQAFNHWLKVPEDKPQIIIEGTEMLHNASLLIDDSEDNSKLRRGFPVAHSIYGIPSVINSANYVYLLGLQKVLTLDHPD
AVKLFTLQLLELHQGQGLDIYWRDNYTCPSEEEYKAMVLQKTGGLFGLAVGLMQLFSDYKEDLKPLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIQA
IWSRPESTQVQNILRQRTENIDIKKKCKL*
4 >lcl|XP_543052.2|Plus137250609..37252105 NW_876277 adenylyltransferase and sulfurtransferase MOCS3 MOCS3 __SEG__ Chr24 {Canis lupus familiaris} MSTYHFPPQTPWPRFSLFQSLGDGKPEPEVPFRTTSRSGAMASREEVLALQAEVARREEELSSLKQRLAAALLAEQAPERRVPVSPLPPKAALSREEILRYSRQLVLPEL
GVHGQLRLAAASVLVVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYAQALTPATALDLVRRYDVVADCSDN
VPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCVFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKVAAGLGPSYSRSLLIFDALRGQFRCIQLRS
RRLDCAACGERPTVTALQDYEAFCGSSATDKCRSLQLLSPEERVSVADYKRLLDSGSPHLLLDVRPQVEVDICRLPHALHIPLKHLERRNAESLKLLGEAIREGKQGAQA
GAAFPVYVICKLGNDSQKAVKILQSLTAVQELESLTVQDVVGGLMAWAAKIDGTFPQY*