SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau H    

ID / Description / Sequence
1 >lcl|NP_777220.1|Plus12493055..2494176 NW_001492891 lipoyltransferase 1 precursor LIPT1 __SEG__ Chr11 {Bos taurus} MLIPFSMKNCFQLLCNLKVPAAGFKNTVKSGLILQSISNDVYHNLAVEDWIHDHMNLEGKPVLFLWRNSPTVVIGRHQNPWQECNLNLMREEGVKLARRRSGGGTVYHDM
GNINLTFFTTKKKYDRMENLKLVVRALKAVHPHLDVQATKRFDLLLDGQFKISGTASKIGRNAAYHHCTLLCGTDGTFLSSLLKSPYQGIRSNATASTPALVKNLMEKDP
TLTCEVVINAVATEYATSHQIDNHIHLINPTDETVFPGINSKAIELQTWEWIYGKTPKFSVDTSFTVLHEQSHVEIKVFIDVKNGRIEVCNIEAPDHWLPLEICDQLNSS
LIGSKFSPIETTVLTSILHRTYPGDDELHSKWNILCEKIKGIM*
2 >lcl|XP_002703545.1|Plus1978141..978638 NW_001494530 6-pyruvoyltetrahydropterin synthase-like LOC100296082 __SEG__ Chr29 {Bos taurus} MNGAGLGPGWWARVSRLVSFSASHRLHSKSLSNEENLKLFGKCNNPNGHGHNYKVVVTVHGEVDPVTGMVMNLTDLKEYIEEAIMKPLDHKNLDLGVPYFADIVSTTENV
AVYIWENLQKFLPVGVLYKVKVYETDNNIVVYKGEQLLEISFHPYLKKIFIPLSN*