SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr G    

ID / Description / Sequence
1 >lcl|NP_001072136.1|Plus1338901..340244 NW_003299635 N-acetylglucosaminyltransferase I LOC780412 __SEG__ Chr2 {Sus scrofa} MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRLPSDSALDDDPASLTREVIRLAQDAEVELERQRGLLQQIREHHARWSQRWRVPTVAPPVPPRVPVTSAPTVIPI
LVIACDRSTVRRCLDKLLHYRPSAEHFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIVVPPDHRKFQGYYKIARHYRWALGQVFEKFKFSAAVVVEDDLEVAPDF
FEYFQATYPLLRADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRQGRACVRPEISRTMTFGRKGVSHGQFFDQH
LKFIKLNQHFVPFTQLDLSYLRREAYDRDFLARVYGAPLLQVEKVRTSERSELGEVRVQYTSRDSFKAFAKALGVMDDLKSGVPRAGYRGIVSFLFRGRRVYLAPPETWD
GYDPSWN*
2 >lcl|NP_001121954.1|Plus1complement(217953..219293) NW_003534072 alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase MGAT2 __SEG__ Chr1 {Sus scrofa} MRFRIYKRKVLILTFVVAACGFVLWSSNGRQRKNEALAPPLLDAEPVRGAGARAGDHPAISVGIRRGSNDSAAPLVAAAPQPEVDNLTLRYRSLVYQLNFDQTLRNVDKV
SSWVPRELVLVVQVHNRAEYLKLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAGVDFCPVLQVFFPFSIQLYPNEFPGTDPRDCPRDLEKNAALKMGCINAEYPDSFG
HYREAKFSQTKHHWWWKLHFVWERVKVLRDYAGLILFLEEDHYVAPDFYHVFKKMWNLKQQECPECDVLSLGTYTTVRSFRDVADKVDVKTWKSTEHNMGLALTRDAYQK
LIECTDTFCTYDDYNWDWTLQYLTVSCLPKFWKVLVPQVPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNSNKQYMFPETLTISEKLTAALSPPRKNGGWGDIRDHELCK
SYRRLQ*
3 >lcl|NP_001191324.1|Plus1<993180..994706 NW_003536280 interferon-induced protein with tetratricopeptide repeats 3 IFIT3 __SEG__ Chr14 {Sus scrofa} SEVNKNSLEKILPQLKCHFTWNLPKEEHVWHDLEDRVCNQTELLNSEFKATMYNLLAYIKHLNGQNEAALEYLQQAEEFIQQEHTDQAEIRSLVTWGNYAWVYYHLGRLS
EAQIYVDKVKQVCEKFSNPYSIECPELDCEEGWTLLKCGGKQIEKAKVYFEKALEEKPDNPEFSSGLAIAMYFLNGKPAQQSSVDILKEAIELSPDNQYIKVLLALTLQK
MNEEAEGEELVVEALEKAPRQTDVLRSAAKFYRVKGDLDKAIELFLTALESTPNNGYLYHQIACCYRAKVKQLLDAGESEASRNREIIEELRKYAKDYVNKAIEKGLNPL
YAYSDSTELLEIGECHQTAFSKELPSTEAQQLHQRSCNSQEYHEKSEDTAAQQSLENLSINTKSTEKEKMKYQLQNGAANQLPQSAPNSWYLRGLIHKMNGDLLQAAACY
EKELGYLLRNSPSGIGSIFQPASELEEGTEEMDQGADGSTLRELPDPGADRDRKERKGTESQGAWNSG*
4 >lcl|NP_998947.1|Plus1complement(1221200..1222453) NW_003535191 phosphoglycerate kinase 2 PGK2 __SEG__ Chr7 {Sus scrofa} MSLSKKLTLDKLDVKGKRVIMRVDFNVPMKRNQVTNNQRIKASLPSIRYCLDNGARSVVLMSHLGRPDGVAMPDKYSLEPVAAELKSLLGKDVLFLKDCVGSEAEQACAN
PPAGSVILLENLRFHVEEEGKGQDPSGNKLKAEPDKVEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKASGFLMKKELDYFAKALENPERPFLAILGGAKVADK
IQLIKNMLDKVNEMIIGGGMAFTFLKVLNNMEIGASLFDKEGATIVKEIMAKAEKNRVNITFPVDFVIADKFEENAKVGQATVASGIPAGWVALDCGPETNKKYAQVVAR
AKLIVWNGPLGVFEWDAFANGTKALMDEIVKATSKGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVEALSNL*
5 >lcl|NP_999116.1|Plus1268808..269782 NW_003534374 probable UDP-sugar transporter protein SLC35A4 NST __SEG__ Chr2 {Sus scrofa} MSVEDGGLPGLGGPGQARWTLMLLLSTATYGAHAPLLALCHVDGRVPFRPSSAVLLTELTKLLLCALSLLVGWQAWPPRTPPWRQAAPFALSALLYGANNNLVIHLQHYM
DPSTYQVLSNLKIGSTALFYCLCLRRRLSARQGLALLLLMAAGACYAAGGLRDPGSPLPESPSTAASGPVPLHVTAPGLLLLLLYCLISGLSSVYTELLLKRQRLPLALQ
NLFLYTFGVLLNLGLHAGGGPGPGLLEGFSGWAALVVLSQALNGLLMSAVMKHGSSITRLFVVSCSLVVNAVLSAALLRLQLTAAFFLAALLIGLAVHLYYGSR*
6 >lcl|NP_999492.1|Plus1633248..634381 NW_003536053 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 B3GNT5 __SEG__ Chr13 {Sus scrofa} MFGSGRRVKKWQFIQIFATCFVLSLMFFWGPIDNHIVSHMKSYSYRYLINSYDFVNDSLSLKRSEDGTPRYQYLINHEEKCQAQDVLLLLFVKTAPENYNRRSAIRNTWG
NEKYVQSQLNANIKTLFVLGTPSDPLMRERLQRRLVWEDHMYSDIIQQDFVDSFYNLTLKFLLQFKWANSFCPHAKFLMTADDDIFIHMPNLIEYLQSLEQMGVQDFWIG
RVHHGAPPVRDKSSKYYVSYDMYQWPAYPDYTAGAAYVISGDVATKVYEASQTLNSSLYIDDVFMGLCANKIGLVPQSHAFFSGEGKTPYHPCIYEKMMTSHGHVEDLQD
LWKDATDPKVKMISKGFFGQIYCRIIKIVLLCKLTYLDTYPCRAAFA*
7 >lcl|NP_999516.1|Plus1complement(551237..552232) NW_001885362 UDP-GalNAc:beta-1, 3-N-acetylgalactosaminyltransferase 1 B3GALNT1 __SEG__ Chr13 {Sus scrofa} MAPALPITLPSKMSLRSLKWSLLLLSLLSFLVMWYLSLPHYNVIERVNWMYFYEYEPIYRQDFHFTLREHSNCSHQNPFLVILVTSHPADVKARQAIRVTWGEKKSWWGY
EVLTFFLLGQQAEREDKVLALSLEDEHLLYGDIIRQDFLDTYNNLTLKTIMAFRWVTEFCPNARYIMKTDTDVFINTGNLVKYLLNLNHSEKFFTGYPLIDNYSYRGFYQ
KTHISYQEYPFKVFPPYCSGLGYIMSRDLVPRIYEMMSHVKPIKFEDVYVGICLNLLKVDIHIPEDTNLFFLYRIHLDVCQLRRVIAAHGFSSKEIITFWQVMLRNTTCH
Y*
8 >lcl|XP_001924755.2|Plus1complement(53166..54146) NW_003536434 beta-1,3-galactosyltransferase 1 B3GALT1 __SEG__ Chr15 {Sus scrofa} MASKVSCLYVLTVVCWASALWYLSVTRPTSSYTGSKPFSHLTVARKNFTFGNIRTRPINPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGI
KIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVINGGPIRDVRSKW
YMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVITVHQISPEEMHRIWNDMSSKKHLRC*
9 >lcl|XP_001926545.3|Plus1245453..246805 NW_001886315 major facilitator superfamily domain-containing protein 5-like LOC100157167 __SEG__ Chr5 {Sus scrofa} MLVTAYLAFVVLLASCLGLELSRCRAKPSGRACSNPSFLRFQLDFYQVYFLALAADWLQAPYLYKLYQHYHFLEGQIAILYVCGLASTVLFGLVASSLVDWLGRKKSCVL
FSLTYSLCCLTKLSQDYFVLLVGRALGGLSTALLFSAFEAWYIHEHVERHDFPAEWIPATFARAAFWNHVLAVMAGVAAEAVACWMGLGPVAPFVAAIPLLALAGALALH
SWGENYDRQRAFSRTCAGGLRCLLSDRRVLLLGTIQALFESVIFIFVFLWTPVLDPHGAPLGIIFSSFMAASLLGSSLYRIATSKRYHLQPMHLLSFAVLIVVFSLFMLT
FSTSPGQESPVESFIAFLLIELACGLYFPSMSFLRRKVIPDTEQTGVLNWFRVPLHLLACLGLLVLHDSDRKTGTRNMFSICSAVMVMALLAVVGLFTVVRHDAELRVPS
PTGEPYAPEL*
10 >lcl|XP_001927603.1|Plus12174371..2175504 NW_003535175 beta-1,3-galactosyltransferase 4-like LOC100155431 __SEG__ Chr7 {Sus scrofa} MRLSLSRRLLLAALLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPNEEACGGPGVPPFLLILVCTAPDNLNQRNAIRASWGRLREARGLRVQTLFL
LGEPSGGSRENDLARESAAHGDIVQAAFQDSYRNLTLKTLSGLNWADKHCPMARYILKTDDDVFVNVPELVSELVRRGGHWEQWEQEPQRKAKVGDEEGGEGSPTSGSQP
VPLLYLGRVHWRVHPSRTPGGRHQIAEEQWPPAWGPFPPYASGTGYLLSASAVELILKVASRAPPLPLEDVFVGVSARRGGLTPTHCVRLAGATHYPLDRCCYGRFLLTS
HRLDPREMQEAWELVGGSDGRRTVPFCSWLQGVLGILRCRVIAWLHS*
11 >lcl|XP_001927684.1|Plus11797934..1798815 NW_003536501 UDP-glucuronosyltransferase 1-10-like LOC100157045 __SEG__ Chr15 {Sus scrofa} MAPVVLTRFLPLCVCLLLSPGFAEAGKLLVVPMDGSHWFTMRSVVEKLIHRGHEVVLVTPEVSWQLTNSFNMTVKTYSTTYTLEDLNREFQIFSDFQWKARQMSMFSMLM
SESTKFFDYFFSHCGSLFNDTKLVKYIEESSFDAVFLDPFDMCGLIVAKYFSLPAVVFTRGPFCHHLEESTQCPMPLSYVPRELSAFSDVMTFGERLRNHIWHLEERLFC
HYFVKRALEIASEIFQTKVTAYDLYSQASVWLLRTDFVLDYPKPVMPNMIFIGGINCHEGKPLPKVRYSPAAY*
12 >lcl|XP_003123142.1|Plus1complement(466256..467341) NW_003534269 galactoside 3(4)-L-fucosyltransferase-like LOC100513844 __SEG__ Chr2 {Sus scrofa} MDPLDSAKIKCSWRHYLPWLFLQLLLALCFFSYLHVSQDAPTWAPEAKAPCQTTAAPSSRPPLLLLLWTWPFHVRVAVSRCSELRPGTADCQLTDNRGEYPRADAVLVHH
REVSSHPQRQLPPSPRPPGQRWVWFSMESPSHCPQLKALDGYFNLTMSYRRDSDIFMPYGWLEPWPGQPVDVQLNISAKNKLVAWVVSNWREDSVRVRYYRQLQAHLQVD
VYGRSHKPLPSSAMTTQLSQYKFYLAFENSLHTDYITEKLWRNALLAWAVPVVLGPSRRNYEQFLPPEAFIHINDFQSPKELAQYLLALDKDDARYLGYFRWRETLRPQF
FSWALMFCKACWRLQQEPSYQTVPSIASWFT*
13 >lcl|XP_003123753.1|Plus1complement(126179..127567) NW_003534301 beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 isoform 1 GCNT4 __SEG__ Chr2 {Sus scrofa} MKTFKCCFKYHLQQKVFILFLTLWLFSLLKLLNVRRILFPQRGIYLVEYSLSTSPFVRNRYTHVKNEIEYEINCSAVYEQEPLEIGKSLEIRKRTIIDLDDDDVVAMTSD
CDIYQALRRYHQKLVSREEESFPIAYSLVVHKDAIMVERLIHAIYNQHNVYCIHYDHKSTDTFKVAMNNLAKCFSNIFIASKLETVQYAHISRLQADLNCLSDLLKSSVQ
WKYVINLCGQDFPLNSNFKLVSELKKLNGSNMLETVKPPSTKMERFMYHHELRQVPYEYVKLPIRTNISKEAPPHNIEIFVGSAYFVLSQAFVKYIFNSSLVEDFFAWSK
DTYSPDEHFWATLIRVPGIPGEISRTAQDVSDLQSKTRLVKWNYLEGLFYPSCTGSHLRSVCIYGAAELRWLLKDGHWFANKFDSKVDPVLIKCLAEKLEEQQREWITLS
SGKLFMVKNPTTTSEHMMEIRV*
14 >lcl|XP_003125160.2|Plus1complement(198258..199451) NW_003534496 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2-like LOC100524195 __SEG__ Chr3 {Sus scrofa} MSVGRRRIKLLGILMMVNVFIYLIVEVSKSSSQEKNGKGEVIIPKEKFWKISEPPKAYWNREQEKLNRRYNPILNMLANQTGEAYGFSNISHLNYCEPDLRVTSVVSDFD
SLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTSHFDRRQAIRESWGKETNVGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNL
SLKEVLFLRWVSTSCPNAEFVFKGDDDVFVNTHHILNYLNSLSKNKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYTGVYPPYAGGGGFLYSGHLALRLYNVTDQVLLYP
IDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNRNNICSYLGLMLVHSRKPQEMIDIWSRLQNAHLSC*
15 >lcl|XP_003126033.2|Plus1681048..682109 NW_003534720 lactosylceramide 4-alpha-galactosyltransferase-like LOC100524987 __SEG__ Chr5 {Sus scrofa} MSRPPECLLRLLPGAPRQRVCTLFIISFKFTFFISVMIYWHIAGEPRGQGPFFSLPSSIPCPHLVPPPPPPGTPRPGSIFFLETSDRTSPNFLFMCSVESAARAHPEARV
AVLMKGLPGGNASLPRHLGLSLLSCFPNVQMLPLDLEELFRDTPLAAWYAAARRRWEPYLLPVLSDASRIALLWKFGGIYLDTDFIVLKNLRNLTNALGTQSRYVLNGAF
LAFERHHEFMALCMRDFVAHYNGWIWGHQGPQLLTRVFKKWCSIRSLRQSHSCRGVTALPSEAFYPIPWQDWKKYFEDISPEALPRLLNATYAVHVWNKKSQGTRLEVTS
QALLAQLQARYCPATHEVMKMYS*
16 >lcl|XP_003127204.1|Plus1complement(116448..117641) NW_003534954 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8-like LOC100511757 __SEG__ Chr6 {Sus scrofa} MRCPKCLLCLSALLTLLGLKVYIEWTSEPRLGKAHPGPRGTPPGPTSASSEPTLPANLSARLGQLGPLASAYWNQQQWRLGTLPSGDSTEAGDCRAWGAAAAAEIPDFTS
YPEDLRRFLLSAACRSFPRWLPRGSGGQVAGCEDPDIPYLLLAIKSEPGRFAERQAVRETWGGPAPGVRLLFLLGSPEGKAGPDLGSLVAWESRRYSDLLLWDFLDVPFN
QTLKDLLLLAWLGRHCPGVSFILQAQDDAFVHTPALLDHLRALPPGKARGLYLGEVFTQAKPLRRPGDPFYVPGSFFEGGYPAYASGGGYIIAGRLAPWLLQAAARVAPF
PFNDVYTGLCFQALGLAPRTHKGFLTAWPADRTADPCAFRDLLLVRPLSPQNSIRLWKQLQDPQLQC*
17 >lcl|XP_003127536.1|Plus1complement(295172..296143) NW_003300110 beta-1,3-galactosyltransferase 6-like LOC100523125 __SEG__ Chr6 {Sus scrofa} MRLLRRAWRHRTALGLGCLALGGATLLYLARCAAPPAPAPAPAAQARAVAFLAVLVASAPRAAERRSVVRSTWLAARRGGPGDVWARFAVGTDGLGAEERRALEREQARH
GDLLLLPTLRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDSFARLDALLADLRARDPARRRRLYWGFFSGRGRVRPGGRWREAAWQLCDYYLPYALGGGYVLSADLVH
YLRFSREYLRAWHSEDVSMGAWLAPVDVQREHDPRFDTEYKSRGCSNQYLVTHKQSLEDMLEKHQTLERDGRLCKREVQLRLSYVYDWSAPPSQCCQRKEGIP*
18 >lcl|XP_003129421.2|Plus1374127..375788 NW_003300494 glycerol kinase 2-like LOC100514782 __SEG__ Chr8 {Sus scrofa} MAAPKTTGVGPLVGAVVQGTNSTHFMVFNSKTAELLSHHQVELTQVFPKEGWVEQDPKLILQSVYECIERTCEKLEELHVDLSNIKAVGVSNQRETTVVWDRLTGEPLYN
AVVWLDLRTQSTVELLSKKIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVSQVQKAVREGRALFGTIDSWLIWSMTGGAHGGIHCTDVTNASRTMLFNIHSLQWDKELC
DFFEIPMGILPDVWSSSEIYGLMKTGALEGVPISGCLGDQSAALVGQMCFQEGQAKNTYGTGCFLLCNTGHKCVFSEHGLLTTVAYKLGKDQPVCYALEGSVAIAGAVIR
WLRDNLGIIKTSEESEKLAKEVGTSYGCYFIPAFSGLYAPYWEPTARGIICGLTQFTNKSHIAFAALEAICFQTREILDAMNRDCGIPLNHLQVDGGMTTNKVLMQLQAD
ILHIPVIRASMPETTALGAAMAAGAAHGVDVWSLKPEDLSTVMMERFEPQIKATESEIRYSTWKKAVMKSMGWVTTQPPESSEPTLFSSLPLGFFIVSSMILLIGARYIS
GIP*
19 >lcl|XP_003129726.1|Plus1136932..138071 NW_003300516 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6-like LOC100524328 __SEG__ Chr9 {Sus scrofa} MAFPRRQSMKPKNLTCLLVGVNFLVLYLWFLQAPRSQQERMWAGSSQADRVTPVAAPRSSPGPRCVANTSANSTADFEQLPARIQDFLRYRHCRHFPLLWDAPAKCAGSH
GAFLLLAIKSSPANYERRDLIRRTWGQERSYIGRQVRRLFLLGIAAPEDAERAEQLAALVALEAREHGDVLQWAFADTFLNLTLKHVHLLDWLEARCSRVHFLLSGDDDV
FVHTANVVRFLEGQPPDHHLFTGQLMSGSVPIRDSWSKYFVPPQLFAGPAYPTYCSGGGFLMSSRTIQAVRKAARLTPLFPIDDAYMGMCLDRAGLEPSGHEGIRPFGVQ
LPGAGQPSFDPCVYRELLLVHRFAPYEMLLMWKALHDPGLTCDRRRRVS*
20 >lcl|XP_003130525.1|Plus1complement(397138..398406) NW_003535648 beta-1,3-galactosyltransferase 2-like LOC100525885 __SEG__ Chr10 {Sus scrofa} MLQRRRRHCCFAKMSWSAKRSLFRTRLTAVLSLVFLFAMFLCFNHHDWLPGRAGFKENPVTYTLRGFRSTKSETNHSSLRNIWKETVPQTLRPQTATNSNHTDLSPQGVT
GLENTLSANGSIYSEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAEPGQIEARRAIRQTWGNESLAPGIRITRIFLLGVSVKLQGHLQRAILEESRQHHDIIQQEY
LDTYYNLTIKTLMGMNWVATYCPQSPYVMKTDSDMFVNTEYLIHKLLKPDLPPRHNYFTGYLMRGYAPNRNRDSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKV
SLGIRRLHLEDVYVGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRKLH*
21 >lcl|XP_003132823.1|Plus1122370..123305 NW_003536143 beta-1,3-galactosyltransferase 5-like LOC100516832 __SEG__ Chr13 {Sus scrofa} MAYVKMRWVYVSLVVVGALCLYFSLDSLSPSQGEPLAFKKKNEDFLQLPDIDCRQDPPFLVLLVTSSHEQLLARKAIRQTWGKASTVQGKRIRSFFLLGTTNSGDLSRAV
AQEIEQYHDIIQKDFLDVYFNLTLKTMMGMEWVSRFCPQATFVMKTDSDMFVNIYYLTDLLLAKNRTTRFFTGFLKLNEYPIRRRYNKWFVSKYEYPWEKYPPFCSGTGY
VFSSDVAGQVYGVAESVPFIKLEDVFVGLCLEKLQIKLEELHSKQTFFPDGLPFTICRYRRIVASHHVKPQDLLNYWQALEGSLEAECPEA*
22 >lcl|XP_003133723.1|Plus1complement(68957..70618) NW_003536486 glycerol kinase-like LOC100523928 __SEG__ Chr15 {Sus scrofa} MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIEQKFPKEGWVEQDPKEILQSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKLTGEPLYN
AVVWLDLRTQSTVANLSKIIPVNNNFVKTKTGLPLSTYFSAVKLRWLLDNVRKIQKAVEEDRALFGTIDSWLIWSLTGGARGGVHCTDVTNASRTMLFNIHSLEWDKELC
EFFEVPMKILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGHKCVFSEHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVVR
WLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTNNKILMQLQAD
ILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLKPEDLSAVTMERFEPQINAKESEIRYSTWKKAVKKSMGWVTTQYPENGDPSIFSSLPLGFFIVSSMVMLIGARYLS
GVA*
23 >lcl|XP_003135374.2|Plus11339684..1340640 NW_003536841 c1GALT1-specific chaperone 1-like LOC100511613 __SEG__ ChrX {Sus scrofa} MLSESSSFLKGVMLGSIFCALITTLGHIRIFHGNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFQVYCIILVKPKDVSLWAAVKETWTKHCDQAEFFSSENVKVFES
INMETNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTVKSGDLEYVSVEGGIVLSIESMKRLNSLLDIPEKCPEQGGMIWKISED
KQLAVCLKYAGVFAENAEDAEGKDVFNTKSVGLFIKEAMTNHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHIFSDALIFLPPNGSDND*
24 >lcl|XP_003353312.1|Plus11348600..1349679 NW_003533943 alpha-(1,3)-fucosyltransferase-like LOC100155421 __SEG__ Chr1 {Sus scrofa} MTSASKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILIWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNRSHAVLIHH
RDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQ
AFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFW
ESHACLACDHVKRHQEYKSVGNLEKWFWN*
25 >lcl|XP_003354313.1|Plus1complement(710715..711992) NW_003534360 chondroitin sulfate synthase 3-like LOC100621408 __SEG__ Chr2 {Sus scrofa} MAVRSRRPWMSVALGLVLGFTAASWLIAPRVAELSERKRRGSSLCSYYGRSAAGPGAQQPLPQPHARPWPEQSPPPARQELQGPQLPEAAPGGTNFRSSPWQQLPPLQQR
RRGRESGGATGLPGAPVAEGEPEEEDGGAAGQRRGGRPGSSHNGSGDGGATAPSSRPRDFLYVGVMTAQKYLGSRALAAQRTWARFIPGRVEFFSSQQPPNAGLGQPPPP
LPVIELPGVDDSYPPQKKSFMMIKYMHDHYLDKYEWFMRADDDVYIKGDLPALAVPPPRLPNSFLCNQPHSLPSLNPCQPLSASLPACAPGSCSPQPVAPTARVRPPFLV
RSSSPPAVWTLLTPAPLFLPSSFLPFLLTPIPRSYSFSCRKVRKGTSGLNLRLFPLHPALKARGGGSFPTSVRRGVSSVAKGRMEDAGESQTGDR*
26 >lcl|XP_003354363.1|Plus1complement(525082..526056) NW_003534374 probable UDP-sugar transporter protein SLC35A4-like LOC100620988 __SEG__ Chr2 {Sus scrofa} MSVEDGGLPGLGGPGQARWTLMLLLSTATYGAHAPLLALCHVDGRVPFRPSSAVLLTELTKLLLCALSLLVGWQAWPPRTPPWRQAAPFALSALLYGANNNLVIHLQHYM
DPSTYQVLSNLKIGSTALFYCLCLRRRLSARQGLALLLLMAAGACYAAGGLRDPGSPLPESPSTAASGPVPLHVTAPGLLLLLLYCLISGLSSVYTELLLKRQRLPLALQ
NLFLYTFGVLLNLGLHAGGGPGPGLLEGFSGWAALVVLSQALNGLLMSAVMKHGSSITRLFVVSCSLVVNAVLSAALLRLQLTAAFFLAALLIGLAVHLYYGSR*
27 >lcl|XP_003354848.1|Plus1complement(134975..136168) NW_003534496 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2-like LOC100622745 __SEG__ Chr3 {Sus scrofa} MSVGRRRIKLLGILMMVNVFIYLIVEVSKSSSQEKNGKGEVIIPKEKFWKISEPPKAYWNREQEKLNRRYNPILNMLANQTGEAYGFSNISHLNYCEPDLRVTSVVSDFD
SLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTSHFDRRQAIRESWGKETNVGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNL
SLKEVLFLRWVSTSCPNAEFVFKGDDDVFVNTHHILNYLNSLSKNKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYTGVYPPYAGGGGFLYSGHLALRLYNVTDQVLLYP
IDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNRNNICSYLGLMLVHSRKPQEMIDIWSRLQNAHLSC*
28 >lcl|XP_003355152.1|Plus1952928..954199 NW_003299865 GPI mannosyltransferase 1-like LOC100627870 __SEG__ Chr4 {Sus scrofa} MGSATHWGEWFLNLRVSPSGVFGVAFLARVALVFYGVFQDRTLLVKYTDIDYQVFTDAARFVTEGRSPYLRATYRYTPLLGWLLTPNIYVSELFGKFLFISFDLLTAFLL
YRLLLLKGLGQRQACGYCVFWLLNPLPMAVSSRGNADSIVASLVLMALYLIEKKFVARAAVFYGFAVHLKMYPVTYILPIALHLLPERDREEDLRQSRYSFHARLFQFLK
RLCNRAVLLFAAVAGLTFFALSFGFYYKYGWEFLEHTYLYHLTRRDIRHNFSPYFYMLYLTAESKWSFPLGIAAFLPQLILLLAVSFAYYRDLVFCCFLHTSIFVTFNKV
CTSQYFLWYLCLLPLVMPLVRMSWRRAVVLLMLWFIGQALWLAPAYVLEFQGKNTFVFIWLAGLFFLLINCYILIQIISHYQKKPWTDTTKYD*
29 >lcl|XP_003356569.1|Plus190142..91095 NW_003535143 n-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, isoform A-like isoform 1 LOC100628070 __SEG__ Chr7 {Sus scrofa} MGSWKHGLFCVSLVTVLICVFIYNNKLWPRKNVFRASLANASLLAEACQQIFKGKVFYTTENALKMTLHETTCYKYMAQSHYITETLSEEEAGFPLAYVMTIHKDFGTFE
RLFRAVYMPQNVYCVHVDAKATTEFKDAVEHLLSCFPNAFLASKTEPVVYGGISRLQADLNCIKDLAASAVPWKYAINTCGQDFPLKTNREIVQYLKGFKGKNITPGVLP
PAHAIGRTRYVHREHLGEKNSFVIKTTKLKTPPPHNMTIYFGTAYVALTRNFANFVLQDQQAIDLLSWSRDTYSPDEHFWVTLNRIPGMAVSLFWFL*
30 >lcl|XP_003356925.1|Plus1complement(428691..429647) NW_003535343 c1GALT1-specific chaperone 1-like LOC100622121 __SEG__ Chr8 {Sus scrofa} MLPESISFLKGVMLGSICCALITVLGHMRIGHGNRLHRHEHHHLQAPNEEEILKISGDERMELGKSFRVYCLIPVKPKDVSLWAAVKETWTKHCDKAEFFSSENVPVFES
INMETNDMWLIMRKAYKYAFDKYREQYHWFFLARPATFAIIENLKYFLLKKDPSQPFYLGHTVKPGDLEYVSVEGGIVLSRESMKRLHRLLNIPEKCPEQGGMIWKISED
KQLAICLKYAGVFAENAEDAEGKDVFNTKAAGLFIKEAMTNHPNQVVEGCCSDMAVTFYGLTPNQMHVMMYGVYRLRAFGHIFNDALIFLPPNGSDND*
31 >lcl|XP_003357094.1|Plus1complement(<34858..35118) NW_003535438 2-hydroxyacylsphingosine 1-beta-galactosyltransferase-like LOC100628237 __SEG__ Chr8 {Sus scrofa} MNLLQRMKNTGVYLISRLAVSFLVLPRYERIMQKYNLLPEKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPE
32 >lcl|XP_003359727.1|Plus1complement(1615318..1616076) NW_003536501 UDP-glucuronosyltransferase 1-3-like LOC100626734 __SEG__ Chr15 {Sus scrofa} MAMGFQAPLPMLAGLLLCLCVVVPWAEGGKVLVVPMEGSHWLSMRKAVQELHARGHQAVVLSPEVNMHIKAEDFFTVKSYATPYTQDEFDDLMVGHFHLLFEKVNFLTMF
WTTMVSLKKVFLMFERSCEELLNNKDLIRDLNASSFDVVLTDPVYPCGAVLAKYLSIPAVFFLRSLPCDLDFEGTACPNPFSYVPKLLTMNSDHMTFFQRVKNMLYPLAL
KYICHVFVTPYAQMASKLRNQNRHHADGPRAA*