SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor G    

ID / Description / Sequence
1 >lcl|NP_001004077.1|Plus12841686..2843350 NW_047422 glycerol kinase 2 Gk2 __SEG__ Chr14 {Rattus norvegicus} MADSKETPEEPLVGAVVQGTNSTRFLVFNPKTAELVGSHQVELTQEYPKEGWVEEDPKEILQSVYECIAKTCEKLTEANIDTSKIKAIGVSNQRETTVVWDKFTGEPLYN
AVVWLDLRTQSTVESLNKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNLRPIQKAVEEDRALFGTIDSWLIWCMTGGVNGGIHCTDVTNASRTMLFNIHSLEWDKELC
KFFEIPMSILPNVRSSSEIYGQMTSGALEGVPISGCLGDQSAALVGQMCFQEGQAKNTYGTGCFLLCNTGQKCVFSEHGLLTTVAYKLGKNKPAFYALEGSVAIAGAVIR
WLRDNFELITSSGEVEDLAREVGTAYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREIVDAMNRDCGIPLSHLRVDGRMTNNKILMQLQAD
ILHIPVVKSVMPETTALGAAMAAGAAEGIDVWSIEPEDLSSMLMERYEPQIQATESEIRFSTWKRAVMKSMGWVTAKDPESNANPVFACLPLGFFIVSSMTLLIGARCIS
YAEE*
2 >lcl|NP_001012130.1|Plus116705793..16707046 NW_047813 phosphoglycerate kinase 2 Pgk2 __SEG__ Chr9 {Rattus norvegicus} MALSSKLTLDKVDVKEKRVIMRVDFNVPMKNNQITNNQRIKAAIPSIKYCLDNGATSVVLMSHLGRPDGIPMPDKYSLQPVAAELKSLLNKDVIFLKDCVGSEIEKACAN
PGKGSVILLENLRFHVEEEGKGKDASGQKITAEPDKVEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGINLPQKASGFLMKKELDYFSKVLEKPERPFLAILGGAKVTDK
IQLIKNMLDKVNFMIIGGAMAFTFLKELKNMKIGASLFDEDGAKIVKEIMDKAEKNGVKITFPVDFVTGDKFDEHAKVGQATVESGIPSGWMGLDCGPESIKNNAQIVAQ
AKLIVWNGPLGVFEWDGFAKGTKALMDEVVKATSNGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKTLPGVEALSNM*
3 >lcl|NP_001013176.1|Plus1complement(46028582..46029577) NW_047625 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase 1 B3galnt1 __SEG__ Chr2 {Rattus norvegicus} MAPAVLTAIPNRMSLRSLKWSLLLLSLLSFLVIWYLSLPHYNVIERVNWMYFYEYEPIYRQDFQFTLREHSNCSQQNPFLVILVTSRPSDVKARQAIRVTWGEKKTWWGH
EVLTFFLLGQEAEREDKVLALSLEDEHALYGDIIRQDFLDTYNNLTLKTIMAFRWVIEFCPNAKYVMKTDTDVFINTGNLVKYLLNLNHSEKFFTGYPLIENYSYRGFFH
KNHISYQEYPFKVFPPYCSGLGYIMSGDLVPKIYEMMGHVKPIKFEDVYVGICLNLLKVDIHIPEDTNLFFLFRIHLDVCQLRRVIAAHGFSSKEIITFWQVMLRNTTCH
Y*
4 >lcl|NP_001013965.1|Plus122753452..22754546 NW_047760 aldolase A-like 1 Aldoal1 __SEG__ Chr6 {Rattus norvegicus} MPYPYLALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNSCIGGVILFHETLYQKTDDGRPFPQVIKSKGGVVGIKVD
KGVVTLAGTDGETTTQGLDDLSGRCAQYKQDGADFAKWRCVLKIGKHTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDH
HVYLEGTLLKPNMVTPGHTCTQKFSSEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKEENKKAAQEEYIK
RALANSLACQGKYTPSDESGAVASESLFISNHAY*
5 >lcl|NP_001025204.1|Plus16747916..6748866 NW_048032 C1GALT1-specific chaperone 1 C1galt1c1 __SEG__ ChrX {Rattus norvegicus} MLSESSSFLKGVMLGSIFCALITMLGHIRIGNRMHHHEHHHLQAPNKDDILKISETERMELSKSFQVYCIVLVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESIN
MDTNDMWLMMRKAYKYAYDKYKDQYNWFFLARPTTFAVIENLKYFLLRKDPSQPFYLGHTVKSGDLEYVSVDGGIVLSIESMKRLNGLLSVPEKCPEQGGMIWKISEDKQ
LAVCLKYAGVFAENAEDADGKDVFNTKSVGLFIKEAMTNQPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHVFNDALVFLPPNGSEND*
6 >lcl|NP_001028244.1|Plus1complement(21536309..21537058) NW_047798 triosephosphate isomerase LOC500959 __SEG__ Chr8 {Rattus norvegicus} MAPSRKFFVGGNWKMNGKKKCLGELICTLNAAKMPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDELI
GQKVNHALSEGLGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKCNVSEEVAQCTRIIYGGSVTGATCKE
LASQPDVDGFLVGGASLKPEFVDIINAKQ*
7 >lcl|NP_001099357.1|Plus136636923..36637849 NW_047354 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 B3galt5 __SEG__ Chr11 {Rattus norvegicus} MAHMKTRLLYASVLTMGALCLYFSMESFQELPFVFKKSHGKFLQLPEIDCKQKPPFLVLLVTSSHKQLAARMAIRKTWGRETSVQGQPVRTFFLLGSSDSTEDMDATALE
SEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGYLTELLLKKNKTTRFFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFS
SDVAIQVYNVSESVPFIKLEDVFVGLCLAKLKIRPEELHTKQTFFPGGLRFSVCRFQKIVACHFMKPQDLLTYWQALETSKDEDCPAV*
8 >lcl|NP_001099408.1|Plus1complement(5643833..5644882) NW_047375 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 B3gnt4 __SEG__ Chr12 {Rattus norvegicus} MLRRLGCVLFCTLVVLLLGCLLFLKERTPAGSSEAHQHFLAPPRPHHSQCSPNLTVVNTSLSLPSRHRLFLTYRHCRNFSILLEPSECARDIFLLLVIKSQPAHIEQRAA
IRSTWGRGGSWARGRQLKLVFLLGVAGPVPPAQLLAYESWQFDDILQWDFAEDFFNLTLKELHVQRWIAAACTQAHFILKGDDDVFIHVPNVLEFLEGWDPAQDLLVGDV
IRLARPNRNTKVKYFIPFSMYRARHYPPYAGGGGYVMSQATVRHLHTAMEEAELFPIDDVFVGMCLRKLGVTPIHHAGFKTFGIQQPLNPRDPCLYRGLLLVHRLSPLEM
WTMWALVTDERLECAARKP*
9 >lcl|NP_001099550.1|Plus1complement(7258196..7260079) NW_047470 transketolase-like 2 Tktl2 __SEG__ Chr16 {Rattus norvegicus} MALARDAKLESDIFQALQDVANRLRIHSIRATCASSSGHPTSCCSAAEIMAVLFFHTMRYKQADPEHPDNDRFVLSKGHAAPILYAVWVEVGRICESDLLNLRKIHCDLE
GHPTPRLSFVDVATGSLGQGLGAACGMAYTGKYFDKASYRVFCLMGDGESSEGSVWEALAFASHYKLDNLLAIFDVNRLGQSGTAPLEHCTDIYETRCQAFGWNTYVVDG
HDVEALCQAFWKAAQVKNKPTALIAKTFKGRGIPNVEDAENWHGKPMPKDRVDGIVKLIESQIQTNRNLTPKPPVEDSPRISISNTKMTSLPAYKLGDMIATREAYGVAL
AKLGHSNQRVIVLDGDTKNSTFSEVFKKEHPERFIECFIAEQNMVSVALGCATRGRTIAFVSTFAAFLTRAFDQIRMGAISQTNVNFVGSHCGVSIGEDGPSQMALEDLA
MFRSIPNCTIFYPSDAVSTEHAIYLAANTKGMCFIRTTRPKLAVIYTSEENFVIGQAKVIRHSADDKVTVVGAGVTLHEALEAADELSQQGISIRVIDPFTIKPLDASTI
IQSAKATGGQIITVEDHYREGGIGEAVCAAISREPDIVVHQLAVTEVPRSGKPSELLDMFGISARHIIAAVKDTVMK*
10 >lcl|NP_001099681.1|Plus1complement(14321952..14323130) NW_047561 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6 (core 3 synthase) B3gnt6 __SEG__ Chr1 {Rattus norvegicus} MALPCSRRSKTPKTLAFLLVGMTFVVLNQWLLQEPMREKANGSVVTPWSSEAAVLRLPLLPAPPCAANVSVDLLDGFQELPARIQDFLRYRHCRRFPQLWDAPHKCVGPR
GVFLLLAVKSSPAHYERRELIRRTWGQERSYSGQQVRRLFLVGTSSPEEAAREPQLADLLSLEAREHGDVLQWDFKDTFLNLTLKHLHLLDWTEEHCPGMSFLLSCDDDV
FVHTANVLRFLEVQSPERHLFTGQLMAGSVPIRESWSKYFVPRQLFPGTAYPVYCSGGGFLMSRRTAQDLRRASHHVPLFPIDDAYMGMCLQQAGLAPSNHEGIRPFGVQ
LPGTKRSSFDPCMYRELLLVHRFAPYEMLLMWKALHDPALQCSHRQDAGSPEARGEMISDAH*
11 >lcl|NP_001100710.1|Plus1complement(20530048..20531241) NW_047430 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 B3gnt2 __SEG__ Chr14 {Rattus norvegicus} MSVGRRRVRLLGILMTANVFIYLIVEVSKSSSQDKNGKGGVIIPKEKFWKLSSLPRAYWNREQEKLNRWYNPILNRVANQTGDLFTSPNTSHLNYCEPDSTVMTAVTDFN
NLPDRFKDFLLYLRCRNYSLLIDQPKKCAKKPFLLLAIKSLIPHFARRQAIRESWGRETNVGNQTVVRVFLLGKTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNL
SLKEVLFLRWVSTSCPDAEFVFKGDDDVFVNTHHILNYLNSLSKSKAKDLFIGDVIHNAGPHRDKKLKYYIPEVFYTGVYPPYAGGGGFLYSGPLALRLYNVTDRVHLYP
IDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKKNICSYIDLMLVHSRKPQEMIDIWSQLQSPNLKC*
12 >lcl|NP_001100962.1|Plus14253923..4255092 NW_047556 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 B3gnt8 __SEG__ Chr1 {Rattus norvegicus} MRCRKCQLCLSALLTLLGLKVYIEWTSESWLKKAEPRGALPSPTPPSAEPTLPTNLSARLGQTGPLSSAYWNQQQRQLGVLPSSDCQTWGSVAASEILDFILYPQDLRRF
LLSAACRSFPLWLPAGEGSPVASCSDKDVPYLLLAVKSEPGHFAARQAVRETWGSPVAGTRLLFLLGSPLGMGGPDLTSLVTWESRRYGDLLLWDFLDVPYNRTLKDLLL
LTWLSHHCPKVSFVLQVQDNAFVHIPALLEHLQALPPTWARSLYLGEVFTQAKPLRKPGGPFYVPKTFFEGDYPAYASGGGYVISGRLAPWLLQAAARVAPFPFDDVYTG
FCFRALGLAPRAHPGFLTAWPAERTRDPCAVRGLLLVHPVSPQDTIWLWRHLWVPELRC*
13 >lcl|NP_001102424.1|Plus119323395..19324375 NW_047655 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1 B3galt1 __SEG__ Chr3 {Rattus norvegicus} MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTFGNIRTRPINPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGI
KIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVINGGPIRDVRSKW
YMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVITVHQISPEEMHRIWNDMSSKKHLRC*
14 >lcl|NP_001102441.1|Plus1complement(33230340..33232490) NW_047711 hypothetical protein LOC366360 RGD1309821 __SEG__ Chr5 {Rattus norvegicus} MPQNLQEKSQVYPRHRLGSHAGPKSLEVIPGATMYTFLPDNFSPAKPKPTKELRPLLCSVVLGLLLVLAAVVAWCYYSASLRKAERLRAELLDLNRGGFSIRNQKGEQVF
RLAFRSGALDLDSCSRDGALLGCSRTADGRPLHFFIQTVRPKDTVMCYRVRWEEAAPGRAVEHAMFLGDAAAHWYGGAEMRTQHWPIRLDGQQEPQPFVTSDVYSSDAAF
GGILERYWLSSRAAAIKVNDSVPFHLGWNSTERSMRLQARYHHTSYKPPAGRTAAPELSYRVCVGSDVTSIHKYMVRRYFNKPSRVPASEAFRDPIWSTWALYGRSVDQN
KVLQFAQQIRQHRFNSSHLEIDDMYTPAYGDFDFDESKFPNATDLFHRLRDAGFRVTLWVHPFVNYNSSRFGEGVERELFVREPTGRLPALVRWWNGIGAVLDFTRPEAR
EWFQGHLRRLRSRYNVASFKFDAGEVSYLPPDFSTYKPLSDPSVWSRRYTEMALPFFSLAEVRVGYQSQNISCFFRLVDRDSVWGYDLGLRSLIPAVLTVSMLGYPFILP
DMIGGNAVPERTAGRPDGPGPERELYVRWLEVAAFMPAMQFSIPPWQYDAEVVAIAHKFAALRASLVAPLLLELAGEVTDTGDPIVRPLWWIAPGDETAHRIDSQFLIGD
TLLVAPVLEPGKQERDVYLPAGKWRSYKGELFDKTPVLLTDYPVDLDEVAYFTWAS*
15 >lcl|NP_001102962.1|Plus15452051..5453319 NW_047397 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 B3galt2 __SEG__ Chr13 {Rattus norvegicus} MLQWRRRHCCFAKMSWNAKRSLFRTHLMGVLSLVFLFAMFLFFNHHDWLPGRPGFKENPVTYTFRGFRSTKTETNQSSLRNIWKEVVPQTLRPQTATNSNNTELSPQGVT
GLENTLSANGSIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAEPGQIEARRAIRQTWGNETLAPGIQITRIFLLGISIKLNGYLQHAIQEESIQYHDIIQQEY
LDTYYNLTIKTLMGMNWVATYCPHTPYVMKTDSDMFVNTEYLIHKLLKPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKV
SLGIRRLHLEDVYVGICLAKLRVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACVNAAKEKAGRYRHRKLH*
16 >lcl|NP_001102974.1|Plus1complement(30952987..30953379) NW_048043 hypothetical protein LOC688539 LOC688539 __SEG__ ChrX {Rattus norvegicus} MENTIVLTYYARICYQKGIVLIVAPEILHDGDHGLKHCQYSTEKVLAGYKAVSGYHVYLEGPFLKPNMGNPGHTFTQKFSNKKIAMATVLALHHTMYFPDPRVIFMFGEQ
SEKKGSINFNAINMYCLLKL*
17 >lcl|NP_001119754.1|Plus1243622..244974 NW_047785 hypothetical protein LOC315329 RGD1305138 __SEG__ Chr7 {Rattus norvegicus} MLVTAYLSFVGLLASCLGLELSRCRARPPGRACSNPSFLQFQLDFYQVYFLALAADWLQAPYLYKLYQHYHFLEGQIAILYVCGLASTVLFGLVASSLVDWLGRKKSCVL
FSLTYSLCCITKLSQDYFVLLVGRALGGLSTALLFSAFEAWYIHEHVERHDFPAEWIPATFARAAFWNHVLAVAAGVAAEAVASWMGLGPVAPYVAAIPLLALAGALALR
NWGENYDRQRAFSKTCAGGLRCLLSDRRVLLLGVIQALFESVIFIFVFLWTPVLDPHGAPLGIVFSSFMAASLLGSSLYRIATSKRYHLQPMHLLSLAVLIVVFSLFMLT
FSTSPGQENPVESFIAFLLIELACGLYFPSMSFLRRKVIPETEQAGVLNWFRVPLHLLACLGLLVLHDSDRKTGTRNMFSICSAVMVTTLLAVAGLFTVVRHDAELRVPS
PTGEPYAPEL*
18 >lcl|NP_064481.1|Plus16792257..6793642 NW_047565 interferon-induced protein with tetratricopeptide repeats 1 Ifit1 __SEG__ Chr1 {Rattus norvegicus} ENADGDQVMENLLQLRCHFTWGLLFEKNDIPDLEVRISEQVQFLDIKNSLGMHNLQAYVRHLKGEQEEALQSLKEAEALIEGEQLGKRSLVTWGNCAWVHYHRGSLAEAQ
IYLDKVENVCREFSSPFHYRMECAEIDCEEGWALLKCGGSNYMRAMACFAKALQVDPENPEYNAGYAVVAYRQDFDDNHVSLEPLRKAVRLNPEDPHLKVLLALKLQDLG
EQDEAETHIEEALSSTSCQSYVFRYAAKYFRRKGDINEALHLLHRALQTSPSSGYLHYQKGLCYKQQMIQLKTSGNRQARRQENIQELAHQAICEFQETLNLRPTFEMAY
VCMAEMQAEIGQYEEAEGNFQEALNLNNLVAHIEQDIHFRYGRFQQFHKKSEDKAITHYLKGLKLEEKSFAWRKLLTALEKVAERRVRQNVRLVESTSLLGLVFKLKGQE
MKALLYYEKALRLSGEMNPAF*
19 >lcl|NP_071555.2|Plus1complement(8227549..8228850) NW_047798 fucosyltransferase 4 Fut4 __SEG__ Chr8 {Rattus norvegicus} MAPAGRKLQHESRCRPSRPVDAWRAAATTRGRCMGTPGARRRARRGGWGLPRTSSGLAAAGLLCTALTACLCWGQLPPLPWASPAPQRPVSVLLWWEPFGGRGGHSKPPP
DCSLRFNISGCRLLTDRAAYGEAQAVLFHHRDLVKGPPDWPPPWGAQERTDEAPELRVFDDQEGAVMLAREALETTGSRPPGQRWVWMNFESPSHTPGLRGLAKDLFNWT
LSYRTDSDIFVPYGFLYPRSHPAEQPSGLGPPLARKRGLVAWVVSHWNERQARVRYYHQLRRHVSVDVFGRAGPGQPVPAVGLLHTVARYKFYLAFENSQHVDYITEKLW
RNAFLAGAVPVVLGPDRANYERFVPRGSFIHVDDFPSAASLAAYLLFLDRNVAVYRRYFHWRRSYAVHITSFWDEPWCQTCRAVQTSGDQPKSIHNLADWFQR*
20 >lcl|NP_071576.1|Plus1complement(1702724..1703806) NW_047781 alpha 1,4-galactosyltransferase A4galt __SEG__ Chr7 {Rattus norvegicus} MGISRSDLEETMSKPPDCLPRMLRGTPRQRVFTLFIISFKFTFLVSILIYWHTVGAPKDQRRQYSLPVDFPCPQLAFPRVSAPGNIFFLETSDRTNPSFLFMCSVESAAR
AHPESQVVVLMKGLPRDTTAWPRNLGISLLSCFPNVQIRPLDLQELFEDTPLAAWYLEAQHRWEPYLLPVLSDASRIALLWKFGGIYLDTDFIVLKNLRNLTNMLGIQSR
YVLNGAFLAFERKHEFLALCIRDFVAHYNGWIWGHQGPQLLTRVFKKWCSIHSLKESRACRGVTALPPEAFYPIPWHELEEIL*RRQPRGASPAAQCHLCCSCVEQEKSG
YTSRGHIQGSAGSATCPLLPYDAQSHDDVLV
21 >lcl|NP_071612.1|Plus1complement(29355140..29356426) NW_047563 glucosaminyl transferase 1, core 2 Gcnt1 __SEG__ Chr1 {Rattus norvegicus} MLRNLFRRRLFSYPTKYYFMVLVLSLITFSVVRIHQKPEFVSVSHLELSGDDPNSNVNCTKVLQGDPEEIQKVKLEILTVQFKKRPRRTPHDYINMTRDCASFIRTRKYI
MEPLTKEEVGFPIAYSIVVHHKIDMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASCFDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMD
FPIKTNLEIVRKLKSFTGENSLETEKMPPNKEERWKKRYTVVDGKLTNTGVVKAQPPLKTPLFSGSAYFVVTREYVGYVLENKNIQKFMEWAQDTYSPDEFLWATIQRIP
EVPGSLPSSHKYDLSDMNAVARFVKWQYFEGDVSNGAPYPPCSGVHVRSVCVFGVGDLSWMLRKHHFFANKFDMDVDPFALQCLEEHLRHKALETLER*
22 >lcl|NP_077058.1|Plus15666985..5668256 NW_047399 phosphatidylinositol glycan anchor biosynthesis, class M Pigm __SEG__ Chr13 {Rattus norvegicus} MSYTKHWGEWFLNLRVPPAGVFGVAFLARVALVFYGVFQDRTLLVRYTDIDYHVFTDAARFVTEGRSPYLRATYRYTPLLSWLLTPNVYLSELFGKFLFISCDLLTAFLL
YRLLLLKGLGRRQACGYCVFWLLNPLPMAVSSRGNADSIVASLVLTTLYLIEKRLIACAAVFYGFAVHMKMYPVTYILPIALHLRPERDSDEGLRLARYSFQARLYDFLK
RLCSWAVLLFVAIAGLTFLALSFGFYYKYGWEFLEHTYLYHLTRRDIRHNFSPYFYMLYLTAESKWSFTLGIAAFLPQFILLSAASFAYYRDLVFCCFLHTSIFVTFNKV
CTSQYFLWYLCLLPLVMPLVRMPWKRAVVLLMLWFIGQALWLAPAYVLEFQGKNTFLFIWLAGLFFLLINCSILIQIISHYKEDRLTERIKYD*
23 >lcl|NP_110488.1|Plus121545677..21547020 NW_047334 alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase Mgat1 __SEG__ Chr10 {Rattus norvegicus} MLKKQSAGLVLWGAIIFVGWNALLLLFFWTRPAPGRLPSDSALGDDPASLTREVIHLAEDAEAELERQRGLLQQIKEHYSLWRQRWRVPTVAPPAWPRVPGTPSPAVIPI
LVIACDRSTVRRCLDKLLHYRPSAEHFPIIVSQDCGHEETAQVIASYGTAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFNKFKFPAAVVVEDDLEVAPDF
FEYFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLADLWAELEPKWPKAFWDDWMRRPEQRKGRACIRPEISRTMTFGRKGVSHGQFFDQH
LKFIKLNQQFVPFTQLDLSYLQREAYDRDFLAQVYGAPQLQVEKVRTNDRKELGEVRVQYTSRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPETWN
GYDPSWN*
24 >lcl|NP_445917.1|Plus1complement(15030082..15031161) NW_047711 alpha-(1,3)-fucosyltransferase Fut9 __SEG__ Chr5 {Rattus norvegicus} MTSTSKGILRPFLIVCIILGCFVACLLIYIKPTNSWVFSPMESASSVLKMKNFFSRKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHH
RDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTSPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQ
AFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDFNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFW
ESHACLACDHVKRHQEYKSVGNLEKWFWN*
25 >lcl|NP_446056.1|Plus138079079..38080407 NW_047760 alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase Mgat2 __SEG__ Chr6 {Rattus norvegicus} MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNDALAPPLLDSEPLRGAGHFAASVGIRRVSNDSAAPLVPAVPRPEVDNLTLRYRSLVYQLNFDQMLRNVDKDGTWSP
GELVLVVQVHNRPEYLRLLIDSLRKAQGIREVLVIFSHDFWSAEINSLISSVDFCPVLQVFFPFSIQLYPSEFPGSDPRDCPRDLKKNAALKLGCINAEYPDSFGHYREA
KFSQTKHHWWWKLHFVWERVKVLQDYTGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPGCDVLSLGTYTTIRSFYGIADKVDVKTWKSTEHNMGLALTRDAYQKLIECT
DTFCTYDDYNWDWTLQYLTLACLPKVWKVLVPQAPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYLFPETLVIGEKFPMAAISPPRKNGGWGDIRDHELCKSYRR
LQ*
26 >lcl|NP_598237.2|Plus11696150..1697265 NW_047597 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase 4 B3galt4 __SEG__ Chr20 {Rattus norvegicus} MPLSLFRRLLLAVLLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPNPQACGGSGPPPFLLILVCTAPEHLNQRNAIRGSWGAIREARGFRVQTLFL
LGEPMGQQFADLASESAAQGDVLQASFQDSYRNLTLKTLTGLNWVNKYCPMARYILKTDDDVYVNVPELVSELIQRGGPSEQWQKGKEPQEETTAVHKEHKGQAVPLLYL
GRVHWRVRPTRTPESRHHVSEELWPENWGPFPPYASGTGYVLSISAVQLILKVASRAPYLPLEDVFVGVSARRGGLAPTHCVKLAGATHYPLDRCCYGKFLLTSHKVDPW
KMQEAWKLVRGLNGRRTEPFCSWLQGFLGTLRCRFIAWLNS*
27 >lcl|NP_599168.1|Plus17647286..7648935 NW_047513 glycerol kinase-like 1 Gykl1 __SEG__ Chr18 {Rattus norvegicus} MADAPKAVLGPLVGAVDQGTSSTRFLVFNPQTAELLCHHQVEIAQEFPREGWVEQDPKVILQSVYECIEKTCEKLGQQSIDISNIKAIGVTNQRETTIVWDKFTGEPLYN
AVVWLDLRTQSTVENLNKSISASNNFIKIKTGLPISTYFSAVKLHWLIENVKNVQKAIEDGRAFFGTVDSWLIWCMTGGINGGVHCTDVSNASRTMLFNIHSLQWDEELC
EFFGIPMTILPRIRSSSEIYGLMKSGVLEGVPISGCLGDQSAALVGQLCLQDGQAKSTYGTGCFLLCNTGQKCVNSDHGLLTTVAYKMGREEPVYYALEGSVAIAGAVVS
WLKNNLQIIKSSSDIEKLAEKAGTSYGCYFVPAFSGLYAPYWDPSARGIICGLTQFTNKFHIAFAALEAVCFQTREILDAMNSDCGIPLTHLQVDGGMTANKILMQLQAD
ILCIPVMKPFMPETTALGAAMAAGAAEGIRVWSLDPKDLTGVQMEKFEPQINVEESEGRYSTWKRAVMKSMGWVLTQSPDGHDPSIFRSLTLGFYIVSSMVLLIGARYI*
28 >lcl|NP_671481.2|Plus1903618..904592 NW_047511 solute carrier family 35, member A4 Slc35a4 __SEG__ Chr18 {Rattus norvegicus} MSVEDGGMPGLARPKQARWTLMLFLSTAMYGAHAPFLALCHVDGRVPFRPSSAVLLTELTKLLLCAFSLLVGWQTWPQGTPPWRQAAPFALSALLYGANNNLVIYLQRYM
DPSTYQVLSNLKIGSTALLYCLCLGHRLSARQGLALLLLMAAGACYASGGFQEPGNTLPGPRSAAGARPMPLHITPLGLLLLILYCLISGLSSVYTELIMKRQRLPLALQ
NLFLYTFGVILNLGLYAGSGPGPGFLEGFSGWAVLVVLNQAVNGLLMSAVMKHGSSITRLFIVSCSLVVNAVLSAVLLQLQLTATFFLAALLIGLAVCLYYGSP*
29 >lcl|NP_775434.1|Plus1complement(44090266..44091579) NW_047799 beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 Gcnt3 __SEG__ Chr8 {Rattus norvegicus} MVSWRRFCWHYHGWTLGCYMLLAIIALKLSLRLKCDFDVMDLDSKEFQSQYCRDLLYKTLELPAKSSINCSGVIRGEQKAVTQALLNNLELKRKRQSFTEADYLSMTADC
EHFKTQRKFIQVPLSKEEANFPIAYSMVIHEKIENFERLLRAVYTPQNIYCVHVDQKSSETFQQAVRAIVSCFPNVFIANKLVSVVYASWSRVQADLNCMEDLLQSPVPW
EYLLNTCGTDFPIKTNAEMVKALKLLNGQNSMESEVPPPHKTFRWKYHYEVADTLYRTSKEKTPPPNNITMFTGNAYMVASRDFIEHVLSNSKARQLIEWVKDTYSPDEH
LWATLQRASWMPGSDPLHPKFDLSDMRSIARLTKWQDHEGDIENGAPYTSCSGIHQRAICVYGSGDLHWILQNHHLLANKFDPKVDDNVLQCLEEYLRHKAIYGTEL*
30 >lcl|XP_001062726.1|Plus13816462..3817463 NW_047717 glyceraldehyde-3-phosphate dehydrogenase-like LOC685186 __SEG__ Chr5 {Rattus norvegicus} MVKVGVNGFGRIGRLVTRAAFSCDKVDIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHL
KGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIP
ELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQAAEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMA
SKE*
31 >lcl|XP_002727935.1|Plus1complement(15917517..15917855) NW_047356 rCG53026-like LOC688739 __SEG__ Chr11 {Rattus norvegicus} MEKSRNHLKGGDKTVIIFCFSVPSANALMFLINVNQNYDNLLKIVSNASCTINCLAPPDNFGIMEVLMTIVYVITSSQKTVEVSLESCDVMAMVMPRTSSLHPLVLPRLS
PR*
32 >lcl|XP_002728469.1|Plus110818348..10819943 NW_047475 M2 pyruvate kinase-like isoform 1 LOC100362738 __SEG__ Chr16 {Rattus norvegicus} MPKPDSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRAATESFASDPILYRPVAV
ALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKEKGADYLVTEVENGGSLGSKKGVNLPGAAVDLPA
VSEKDIQDLKFGVEQDVDMVFASVIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQM
LESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEAAAVGAVEASFKCCSGAIIVLTKSGRSAHQ
VARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDAVLDAWAEDVDLRVNLAVNVGKTRGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP*
33 >lcl|XP_002729037.1|Plus110175004..10175222 NW_047616 rCG44793-like LOC100359661 __SEG__ Chr2 {Rattus norvegicus} MMKDGVIRFDCMLYLVTKSAFNSGQVYSVTINDPYMVYMFHNDSTNGKFHGLVKVENGKLDYNGKAISIFQE*
34 >lcl|XP_002729039.1|Plus1complement(9063272..>9063694) NW_047616 mCG116123-like RGD1562964 __SEG__ Chr2 {Rattus norvegicus} HHNGKLVMNRMTVTIFQERDPTTIISDAAAEYVVEFPSVFIAMKKAGPYLKGGAKQVIISGYSADVSMFLMGLNRKQYNNLIKIVSNASLITNCLVPQPRSSMTTSAYGR
THDHGPGHHCYLEGRNVTRRNFRPSAKKRN*
35 >lcl|XP_002729208.1|Plus15250461..5250775 NW_047654 rCG37655-like LOC690902 __SEG__ Chr3 {Rattus norvegicus} MVTAVLAEWMLLPSVTPPFKYLVCVFQYDSTHHKGHSTVKAENWNLVINRKAISIFQEQEPTHIKCGDAGAKHGMESTGVFTIMEKPGAYLKDGAKRIIIFPFC*
36 >lcl|XP_002729828.1|Plus116902014..16902247 NW_047774 rCG48651-like LOC100363138 __SEG__ Chr7 {Rattus norvegicus} MAFHVSTHNVSIVDLICCFERVAQYNVIMNVMKQVSKVPRKGLLGYTEDQIMSCEFNSDSYFLPVLVELALFSMTTL*
37 >lcl|XP_002729916.1|Plus16365667..6365867 NW_047798 rCG31824-like LOC689794 __SEG__ Chr8 {Rattus norvegicus} MATVYAITATRKTVDGPFGKLWCDDLGDTQNIIYASTDAAKIVVKTIPELNKKQTGMVFHVPMCSP*
38 >lcl|XP_214281.3|Plus115834994..15836001 NW_047469 glyceraldehyde-3-phosphate dehydrogenase RGD1564958 __SEG__ Chr16 {Rattus norvegicus} MVKLSVNGFGRIGNLVTRAAFCSASGKVDIVAINDPFINLNYMVYIFQYDSTHGKLNGTVKAENGKLVINGKPITIFQEQDPANIKWGDAGAEYVVESTGVFTTVEKAGT
HLKGGGKRVFISAPSADAPMFVMGVNHKKYDNSLKIVSNTSCTTNCLAPLAKVIPDNFGIVEGLMTTVHAITAPQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKV
IPELNGKLTGMAFRVPTPHVSIMDLTCCLEKPAKYDDIKKVVKQAPEGPLKDILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAY
MASKE*
39 >lcl|XP_219750.5|Plus1complement(31321196..>31322212) NW_047563 glyceraldehyde-3-phosphate dehydrogenase RGD1561881 __SEG__ Chr1 {Rattus norvegicus} KKKIVKIGVNGFGCIGCLVTRAAFSSASGKVDIVAINNLFIDLNYMVYMLQYDSTHGKFNGTVKAENAKLVINRKPITIFQDQDPTNIKWGDAGTEYVMESTSVFTTMEK
AGTHLNGGTKRVIISIPLADAPMFVMSMNHEKYDNSLKIVSNASCTTNCLALLAKVIYGNFDIMEGLMTTIHAITATQKNVDGPSGKLWHDGHGAKQNIIPASTGAVKAV
GKVIPELNRKLTGMAFHVPTTNVSIVDLICHLEKPAKCDNIKKVVKQASEGSLKGILGYSEDQVVSCDFNSNSHSSTFDSWAGIALNDNFVKLISWYDNEYAYSNRVVKL
MSYMASKE*
40 >lcl|XP_226431.1|Plus1complement(6633737..6634933) NW_047535 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 B3gnt9 __SEG__ Chr19 {Rattus norvegicus} MRRRPRLCRDAWLTLLLSAALGLLLYAQRDGVSPTTRAPPARGRQLPRPTPGRRALELPNTAHAAPPAYEGETPVPPTPTDPFDFRRYLRAKDQRRFPLLINQPRKCHSD
GASGGSLDLLIAVKSVAADFERREAVRQTWGAEGRVQGALVRRVFLLGVPKGAGSGGAGTRTHWRALLEAESRAYADILLWAFEDTFFNLTLKEIHFLSWASAFCPDVHF
VFKGDADVFVHVRNLLQFLEPRDPAQDLLAGDVIVQARPIRARASKYFIPQAVYGLPVYPAYAGGGGFVLSGATLHRLAHACTQVELFPIDDVFLGMCLQRLRLTPEPHP
AFRTFGISQPSAAPHLRTFDPCFYRELVVVHGLSAADIWLMWRLLHGPQGPVCAHPQPVATGPFQWNS*
41 >lcl|XP_226703.5|Plus11847115..1848518 NW_047617 glucosaminyl transferase 4, core 2 RGD1563891 __SEG__ Chr2 {Rattus norvegicus} MKILRCCFKYTLQQKVFILFLTLWLFSLLKLLNVGRLLFPQRDIYLVEYSLSTSPFVRNRFPDTGDAARDAVNCSGVYEHEPLEIGKSLEIRRRNIIDLEDGDVAVMTSD
CDIYQTLRQYHEKPVSRVEEDFPIAYSLVVHKDAIMVERLIRAIYNQHNLYCIHYDLKSPDAFKAAMNNLAKCFSNIFIASKLEAVEYAHISRLQADWNCLSDLLKSSVQ
WKYVINLCGQDFPLKSNFELVTELKKLRGRNMLETVRPPTGKMERFTYHHELRQVPYEYMKLPVKTNVSKGAPPHDIEVFVGSAYFVLSQAFVKYIFNSSLVKDFFAWSK
DTYSPDEHFWATLIRIPGIPGGISRSSQDVSDLQSKTRLVKWNYYEGFFYPNCTGSHLRSVCIYGAAELRWLIKEGHWFANKFDSKVDPVLIKCLAEKLEEQQRKLIALS
SEKSITEGNPKATHKITTGLRASDTES*
42 >lcl|XP_227659.1|Plus127579715..27580722 NW_047627 glyceraldehyde-3-phosphate dehydrogenase RGD1560826 __SEG__ Chr2 {Rattus norvegicus} MVKISVNGFGHTGCLVTRAAFSSASGKVEIVSINDPFIDLNYTVYMFQYDFTHGKFNDTVKAENGKLVTNGKPITVFQERDPANIMWGDAGAEYVMESTGIFTTMEKAGA
HLKGGAERVIISTLSVDAPVFVMGVNHEKYDNSLKIVSNASCTTNCLTPLAKVIHDNFGIVGGLMTTVHAITATQKTVDCPSGKLWCDGRGAAQNIIPASTGAAKAVGKV
IPELRGKFTSTAFGVPTPSVPVVDLTCCLEKPAKCDNIKKVVKQASEGPLKGILCYTEDQVASCDFNSNSHSSTFDAGAGIALDDNFVKLISRYDNEYGYSNRVVDLMVY
TASKE*
43 >lcl|XP_573304.1|Plus1complement(24075173..24076174) NW_047356 glyceraldehyde-3-phosphate dehydrogenase-like RGD1564688 __SEG__ Chr11 {Rattus norvegicus} MVKVGVNGFGRIGRLVTRAAFSCDKVDIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITTFQERDPANIKRGDAGAEYVMESTGVFTTMEKAGAHL
KGGAKRVIIFAPSADAPMFVVGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHVITATQKTVDGPSGKLWRDGHGAAQNIIPASTGAAKAVGKVIP
ELNRKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQAAEGPLKGILGYTEDQVVSCDFNSNSHFSTFDAGAGIALDDNFVKLISWYDNEYGYSNRVVDLMAYMA
SKE*
44 >lcl|XP_574168.1|Plus1438387..439388 NW_047515 glyceraldehyde-3-phosphate dehydrogenase-like RGD1562758 __SEG__ Chr18 {Rattus norvegicus} MVKVGVNGFGHIGRLVTRAAFSCDKVDIVAINDPFIDLNYMVYMLQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPANIKWGDAGAEYVMESTGVFTTMEKAGAHL
KGGAKRVIISTPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHVITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAVKAVGKVIP
ELNGKLTGMAFCVPTPNVSFVDLTCRLEKPAKYDDTKKVVKQAPESPLKGILGYTEDQVVSCNFNSNSHSSTFDAGAGVALNDNSVKLISWYDNEYGYSNRVVDLMAYMA
SKE*
45 >lcl|XP_574742.1|Plus1complement(1107892..1109490) NW_047600 M2 pyruvate kinase-like RGD1561179 __SEG__ Chr20 {Rattus norvegicus} MPKPDSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSAPITARNTGIICTIGPASRSVEMLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRAATESFASDPILYRPVAV
ALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKEKGADYLVTEVENGGSLGSKKGVNLPGAAVDLPA
VSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICANQM
LESMIKKPRPTRAEGSDVANAVLDGADCIMLSGVTAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEAAAVGAVEASFKCCSGAIIVLTKSGRSAHQ
VARYLPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDAVLDAWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVPR*
46 >lcl|XP_576394.1|Plus113940947..13941948 NW_047799 glyceraldehyde-3-phosphate dehydrogenase-like RGD1565368 __SEG__ Chr8 {Rattus norvegicus} MVKVGVNGFGRIGRLVTRAAFSCDKVDIVAINDPFIDLNYMVYMSQYGSPHGKFNSTVKAENGKLVNNGKPITIFQERDPANIKWGDAGAEYVMESTGIFTTMEKAGAHL
KGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIP
ELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQAAEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMA
SKE*
47 >lcl|XP_578478.3|Plus1complement(6818619..6818804) NW_047717 Glyceraldehyde-3-phosphate dehydrogenase-like RGD1561839 __SEG__ Chr5 {Rattus norvegicus} MVYMFQYDSTHGKFNGTVKAENEKLVINRRPITIFQERDPANILWGDAGDEYVVESTGHSR*