SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ptro G    

ID / Description / Sequence
1 >lcl|NP_001008978.1|Plus11128368..1129447 NW_003457153 alpha-(1,3)-fucosyltransferase FUT9 __SEG__ Chr6 {Pan troglodytes} MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHH
RDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQ
AFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFW
ESHACLACDHVKRHQEYKSVGNLEKWFWN*
2 >lcl|NP_001008985.2|Plus14475490..4477082 NW_003457704 alpha-(1,3)-fucosyltransferase FUT4 __SEG__ Chr11 {Pan troglodytes} MRRLWGAARKPSGAGWEKEWAEAPQEAPGAWSGRLGPGRSGRKGRAVPGWASWPAHLALAARPARHLGGAGQGPRPLDSGTAPFHSRASGERQRRLEPQLQHESRCRSST
PADAWRAEAALPVRAMGAPWGSPTAAAGGRRRWRRGRGLPWTVCVLAAAGLTCTALITYACWGQLPPLPWASPTPSRPVGVLLWWEPFAGRHSAPRPPPDCRLRFNISGC
RLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGVQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESPSHSPGLRSLASNLFNWTLSYRADSDVFVPY
GYLYPRSHPGDPPSGLAPPLSRKQGLVAWVVSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARYKFYLAFENSQHLDYITEKLWRNALLAGAVPVVL
GPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPAVYRRYFHWRRSYAVHITSFWDEPWCRVCQAVQRAGDRPKSIRNLASWFER*
3 >lcl|NP_001009088.1|Plus1complement(1019172..1020296) NW_003458431 alpha-(1,3)-fucosyltransferase FUT5 __SEG__ Chr19 {Pan troglodytes} MDPLGPAKPQWLWRRCLAGLLFQLLVAVCFFSYLRVSRDDATGSPRPGLMAVEPVTGAPNGSRCQDSMATPAHPTLLILLWTWPFNTPVALPRCSEMVPGAADCNITADS
NVYPQADAVIVHHWDIMYNPSANLPPPTRPQGQRWIWFSMESPSNCRHLEALDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKLDSARV
RYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYL
SYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAWFT*
4 >lcl|NP_001009096.1|Plus117419773..17420753 NW_003456847 beta-1,3-galactosyltransferase 1 B3GALT1 __SEG__ Chr2B {Pan troglodytes} MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTFGNIRTRPINPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGI
KIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVINGGPIRDVRSKW
YMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVITVHQISPEEMHRIWNDMSSKKHLRC*
5 >lcl|NP_001009123.1|Plus1complement(3185802..3186851) NW_003458657 lactosylceramide 4-alpha-galactosyltransferase A4GALT __SEG__ Chr22 {Pan troglodytes} MSKPPDLLLRLLRGAPRQRVCTLFIIGFKFTFFVSIMIYWHVVGEPKEKGQLYNLPAEIPCPTLTPPPTLPRPXXXFFLETSTGPPNFLFMCSVESAALSHPESHVLVLM
KGLPGGNASLPRHLGISLLSCFPNVQMLPLDLRELFRDTPLADWYAAVQGRWEPYLLPVLSDASRIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFE
RRHQFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSIRSLAESRSCRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALL
AQLHARYCPTTHEAMKMYL*
6 >lcl|NP_001009150.1|Plus1complement(987737..988816) NW_003458431 alpha-(1,3)-fucosyltransferase FUT6 __SEG__ Chr19 {Pan troglodytes} MDPLGPAKPQWSWRCCLTTLLFQLLVAVCFFSYLRVSRDDPTVYPNGSHFPDSTGTPAHSIPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHR
EVMYNPSAQLPRSPRRQGQRWIWFSMESPSNCRHLEALDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPVHPPLNLSAKTELAAWAVSNWGPNSARVRYYQSLQAHLKVDV
YGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRFF
SWALAFCKACWKLQEESRYQTRSIAAWFT*
7 >lcl|NP_001009163.1|Plus1complement(108659..109423) NW_003459060 probable phosphoglycerate mutase 4 PGAM4 __SEG__ ChrX {Pan troglodytes} MAAYKLVLIRHGESTWNLENRFSCWYDADLSPAGHEEAKRGGQALRDAGYEFDICLTSVQKRVIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTALNKAETAAKHGEA
QVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSYESPKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLQGIAKHVEGLSEEAIMELNLPTGIPIVYEL
DKNLKPIKPMQFLGDEETVCKAMEAVAAQGKAKK*
8 >lcl|XP_001134746.2|Plus198010..99014 NW_003456895 LOW QUALITY PROTEIN: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 B3GNT5 __SEG__ Chr3 {Pan troglodytes} MFFWEPIDNHIVSHMKSYSYRYLINSYDFVNDTLSLKHTSAGPRYQYLINHKEKCQAQDVLLLLFVKTAPENYDRRSGIRRTWGNENYVRSQLNANIKTLFALGTPNPLE
GEELQRKLAWEDQRYNDIIQQDFVDSFYNLTLKLLMQFSWANTYCPHAKFLMTADDDIFIHMPNLIEYLQSLEQIGVQDFWIGRVHRGAPPIRDKSSKYYVSYEMYQWPA
YPDYTAGAAYVISGDVAAKVYEASQTLNSSLYIDDVFMGLCANKIGIVPQDHVFFSGEGKTPYHPCIYEKMMTSHGHLEDLQDLWKNATDPKVKTISKGFFGQIYCRLMK
IILLC
9 >lcl|XP_001142362.1|Plus1complement(5066628..5067575) NW_003456692 c1GALT1-specific chaperone 1-like LOC470362 __SEG__ Chr2A {Pan troglodytes} MVSASGTSFFKGMLLGSISWVLITMFGQIHIRHRGQTQDHEHHHLRPPNRNDFLNTSKVILLELSKSIRVFCIIFGESEDESYWAALKETWTKHCDKAELYDTKNDNLVN
IESNDRWVQMRTTYKYVFEKYGDNYNWFFLALPTTFAVIENLKYLLFTRDASQPFYLGHTVIFGDLEYVTVEGGIVLSRESMKRLNRLLDNSETCADQSVIWKLSEDKQL
AICLKYAGVHAENAEDYEGRDVFNTKPIAQLIEEALSNNPQQVVEGCCSDMAITFNGLTPHKMEVMMYGLYRLRAFGHYFNDTLVFLPPVGSEND*
10 >lcl|XP_001150321.2|Plus1complement(2518336..2519997) NW_003456990 putative glycerol kinase 3 isoform 1 GK __SEG__ Chr4 {Pan troglodytes} MAASKKAVLGPLVGAVDQGTSSTRFLVFNSRTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIGISNIKAIGVSNQRETTVVWDKITGEPLYN
AVVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAIEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLC
EFFGIPMEILPHVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIR
WLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQAD
ILYIPVVKPLMPETTALGAAMAAGAAEGVDVWSLEPEDLSTVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPEGGDPSVFCSLPLGFFIVSSMAMLIGARYIS
GIP*
11 >lcl|XP_001152203.2|Plus123806107..23807300 NW_003456692 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 isoform 1 B3GNT2 __SEG__ Chr2A {Pan troglodytes} MSVGRRRIKLLGILMMANVFIYFIMEVSKSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFN
NLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNL
SLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYP
IDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC*
12 >lcl|XP_001152785.2|Plus1complement(2517..3662) NW_003477330 LOW QUALITY PROTEIN: putative glycerol kinase 3 GK __SEG__ ChrX {Pan troglodytes} KAIGVSNQRETTVVWDKITGEPLYMLRCGLI*EPSLPLRVLVKEFQEIITLSSPRQAFHLALTSVQ*NFVGSLTM*EKFKRPLKKNELFLGLLIHGLFGI*QEESMEVST
IQM*QMQVGLCFSTFILWNGINNSANFLEFQWKFFQMSGVLLRSMA**KLGPWKVCQYLGV*GTSLLHWWDKCASRLDKPKIRMEQDVSYCVIQAISVYFLIMAFSPQWL
TNLAETNQYIMLWKVL*L*LVLLFAG*ETILEL*RPQKKLKNLLKK*VLLMAATSSQHFRGYMHLIGSPAQEG*SVDSLSSPINAILLLLH*KLFVSKLERFWMP*IETV
EFHSVICR*MEE*PATKFLCSYKQTFCTYQ**SPQCPKPLHWVLLWRQGLQK
13 >lcl|XP_001160626.1|Plus1complement(33995469..33997613) NW_003457279 uncharacterized family 31 glucosidase KIAA1161-like LOC465057 __SEG__ Chr9 {Pan troglodytes} MLQNPQEKSQAYPRRRRPGCYAYRQNPEAIAAAAMYTFLPDNFSPAKPKPSKELKPLLGSAVLGLLLVLAAVVAWCYYSVSLRKAERLRAELLDLKAGGFSIRNQKGEQV
FRLAFRSGALDLDSCSRDGALLGCSLTADGRPLHFFIQTVRPKDTVMCYRVRWEEAAPGRAVEHAMFLGDAAAHWYGGAEMRTQHWPIRLDGQQEPQPFVTSDVYSSDAA
FGGILERYWLSSRAAAIKVNDSVPFHLGWNSTERSLRLQARYHDTPYKPPAGRTAAPELSYRVCVGSDVTSIHKYMVRRYFNKPSRVPAPEAFRDPIWSTWALYGRAVDQ
DKVLRFAQQIRQHHFNSSHLEIDDMYTPAYGDFDFDEVRFPNASDMFRRLRDAGFRVTLWVHPFVNYNSSRFGEGVERELFVREPTGRLPALVRWWNGIGAVLDFTHPKA
RDWFQGHLRRLRSRYSVASFKFDAGEVSYLPRDFSTYRPLPDPSVWSRRYTEMALPFFSLAEVRVGYQSQNISCFFRLVDRDSVWGYDLGLRSLIPAVLTVSMLGYPFIL
PDMVGGNAVPQRTAGGDVPERELYIRWLEVAAFMPAMQFSIPPWRYDAEVVAIAQKFAALRASLVAPLLLELAGEVTDTGDPIVRPLWWIAPGDETAHRIDSQFLIGDTL
LVAPVLEPGKQERDVYLPAGKWRSYKGELFDKTPVLLTDYPVDLDEIAYFTWAS*
14 >lcl|XP_001167219.1|Plus1complement(24961448..24962716) NW_003456638 beta-1,3-galactosyltransferase 2 B3GALT2 __SEG__ Chr1 {Pan troglodytes} MLQWRRRHCCFAKMTWNAKRSLFRTHLIGVLSLVFLFAMFLFFNHHDWLPGRAGFKENPVTYTFRGFRSTKSETNHSSLRNIWKETVPQTLRPQTATNSNNTDLSPQGVT
GLENTLSANGSIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAEPGQIEARRAIRQTWGNESLAPGIQITRIFLLGLSIKLNGYLQRAILEESRQYHDIIQQEY
LDTYYNLTIKTLMGMNWVATYCPHIPYVMKTDSDMFVNTEYLINKLLKPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKV
SLGIRRLHLEDVYVGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRKLH*
15 >lcl|XP_001170317.1|Plus13510808..3511944 NW_003457113 beta-1,3-galactosyltransferase 4 B3GALT4 __SEG__ Chr6 {Pan troglodytes} MQLRLFRRLLLAALLLVIVWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPNQEACSGPGAPPFLLILVCTAPENLNQRNAIRASWGGLREARGLRVQTLFL
LGEPNAQHPVWGSQGSDLASESAAQGDILQAAFQDSYRNLTLKTLSGLNWAEKHCPMARYVLKTDDDVYVNVPELVSELVLRGGRWGQWERSTEPQREAEQEGGQVLHSE
EVPLLYLGRVHWRVNPSRTPGGRHRVSEEQWPHTWGPFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGVSARRGGLAPTQCVKLAGATHYPLDRCCYGKFLLT
SHRLDPWKMQEAWKLVGGSDGERTAPFCSWFQGVLGILRCRAIAWLQS*
16 >lcl|XP_001171358.1|Plus125738987..25739919 NT_106996 beta-1,3-galactosyltransferase 5 isoform 1 B3GALT5 __SEG__ Chr21 {Pan troglodytes} MAFPKMRLMYVCLLVLGALCVYFSMYSLNLFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHRQLAERMAIRQTWGKERTVKGKQLKTFFLLGTTSSAAETKEVD
QESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYV
FSGDVASQVYNVSESVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCRFRRIVACHFIKPRTLLDYWQALENSRGEDCPPI*
17 >lcl|XP_001173042.1|Plus114877648..14878964 NW_003457950 beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 isoform 1 GCNT3 __SEG__ Chr15 {Pan troglodytes} MVQWKRLCQRHYLWALGCYMLLATVALKLSFRLKCDSDHLGLESRESQSQYCRTILYNFLKLPAKRSINCSGVTRGDQEAVLQAILNNLEVKKKREPFTDTHYLSLTRDC
EHFKAERKFIQFPLSKEEVEFPIAYSMVIHEKIENFERLLRAVYAPQNIYCIHVDEKSPETFKEAVKAIISCFPNVFIASKLVRVVYASWSRVQADINCMEDLLQSSVPW
KYFLNTCGTDFPIKSNAEMVQALKMLNGRNSMESEVPPKHKETRWKYHFEVVGDTLHLTNKKKDPPPYNLTMFTGNAYIVASRDFVQHVLKNPKSQQLIEWVKDTYSPDE
HLWATLQRARWMPGSVPNHPKYDISDMTSIARLVKWQGHEGDIDKGAPYAPCSGIHQRAICIYGAGDLNWMLHNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL*
18 >lcl|XP_001175035.1|Plus16108298..6109452 NW_003457698 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6 isoform 1 B3GNT6 __SEG__ Chr11 {Pan troglodytes} MAFPCRRSLTAKTLACLLVGVSFLALQQWFLQAPRSPREKRSPQEETPEGPTDAPAADEPPSELVPGPPCVANASANATADFEQLPARIQDFLRYRHCRHFPLLWDAPAK
CAGGRGVFLLLAVKSAPEHYERRELIRRTWGQERSYGGLPVRRLFLLGTPGPEDEARAERLAELVALEAREHGDVLQWAFVDTFLNLTLKHLHLLDWLAARCPHARFLLS
GDDDVFVHTANVVRFLQAQPPGHHLFSGQLMEGSVPIRDSWSKYFVPPQLFPGSAYPVYCSGGGFLLSGPTARALRAAARHTPLFPIDDAYMGMCLQRAGLAPSGHEGIR
PFGVQLPGAQQSSFDPCMYRELLLVHRFAPYEMLLMWKALHSPALSCDRGHRVS*
19 >lcl|XP_003308589.1|Plus1complement(4373767..4375038) NW_003456635 GPI mannosyltransferase 1 PIGM __SEG__ Chr1 {Pan troglodytes} MGSTKHWGEWLLNLKVAPAGVFGVAFLARVALVFYGVFQDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYTPLLGWLLTPNIYLSELFGKFLFISCDLLTAFLL
YRLLLLKGLGRRQACGYCVFWLLNPLPMAVSSRGNADSIVASLVLMVLYLIKKRLVACAAVFYGFAVHMKIYPVTYILPITLHLLPDRDNDKSLRQFRYTFQACLYELLK
RLCNRAVLLFVAVAGLTFFALSFGFYYEYGWEFLEHTYFYHLTRRDIRHNFSPYFYMLYLTAESKWSFSLGIAAFLPQLILLSAVSFAYYRDLVFCCFLHTSIFVTFNKV
CTSQYFLWYLCLLPVVMPLVRMPWKRAVVLLMLWFIGQAMWLAPAYVLEFQGKNTFLFIWLAGLFFLLINCSILIQIISHYKEEPLTERIKYD*
20 >lcl|XP_003309581.1|Plus1495921..496982 NW_003456855 UDP-glucuronosyltransferase 1-10-like LOC460028 __SEG__ Chr2B {Pan troglodytes} MACAGWTSPVPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLERSLNCTVKTYSTSYTLEDQNREFMVFAHAQWKAQAQSIFSLLM
SSSSDFLDLFFSHCRSLFNDRKLVEYLKESSFDAVFLDPFDTCGLIVAKYFSLPSVVFTRGIFCHHLEEGAQCPAPLSYVPNDLLGFSDAMTFKERVWNHIVHLEDHLSC
QYLFRNALEIASEILQTPVTAYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMVSHLSFSTLRIIWLWKLKKDSLLNCDLTFSFVAFQISFQFNKLFC
ANSSTHQLSNFIKLPFLKVYVII*
21 >lcl|XP_003310123.1|Plus1complement(15546547..15547542) NW_003456894 UDP-GalNAc:beta-1, 3-N-acetylgalactosaminyltransferase 1 B3GALNT1 __SEG__ Chr3 {Pan troglodytes} MASALWTVLPSRMSLRSLKWSLLLLSLLSFFVMWYLSLPHYNVIERVNWMYFYEYEPIYRQDFHFTLREHSNCSHQNPFLVILVTSHPSDVKARQAIRVTWGEKKSWWGY
EVLTFFLLGQEAEKEDKMLALSLEDEHLLYGDIIRQDFLDTYNNLALKTIMAFRWVTEFCPSAKYVMKTDTDVFINTGNLVKYLLNLNHSEKFFTGYPLIDNYSYRGFYQ
KTHISYQEYPFKVFPPYCSGLGYIMSRDLVPRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVCQLRRVIAAHGFSSKEIITFWQVMLRNTTCH
Y*
22 >lcl|XP_003310292.1|Plus1complement(806696..808261) NW_003456944 proactivator polypeptide-like 1-like LOC100609404 __SEG__ Chr4 {Pan troglodytes} MLCALLLLPSLLGATRASPTSGPQECAKGSTVWCQDLQTAARCGAVGYCQGAVWNKPTAKSLPCDVCQDIAAAAGNGLNPDAPESDILALVMKTCEWLPSQESSARCKWM
VDAHSSAILSMLRGAPDSAPAQVCTALSLCEPLQRHLATLRPLSKEDTFEAVAPFMANGPLTFHPRQAPEGALCQDCVRQVSRLQEAVRSNLTLADLNIQEQCESLGPGL
AVLCKNYLFQFFVPADQALRLLPTQELCRKGGFCEELGAPARLTQVVAMDGVPSLELGLPRKQSEMQMKAGVTCEVCMNVVQKLDHWLMSNSSELMITHALERVCSVMPA
SITKECIILVDTYSPSLVQLVAKITPEKVCKFIRLCGNRRRARAVHDAYAIVPSPEWDAENQGSFCNGCKRLLTVSSHNLESKSTKRDILMAFKGGCSVLPLPYMIQCKH
FVTQYEPVLIESLKDMMDPVAVCKKVGACHGPRTPLLGTDQCALGPSFWCRSQEAAKLCNAVQHCQKHVWKETPLHAGEHA*
23 >lcl|XP_003310374.1|Plus14332101..4333762 NW_003456959 glycerol kinase 2-like LOC100608988 __SEG__ Chr4 {Pan troglodytes} MAAPKTAAVGPLVGAVVQGTNSTRFLVFNSKTAELLSHHKVELTQEFPKEGWVEQDPKEILQSVYECIARTCEKLDELNIDISNIKAVGVSNQRETTVIWDKLTGEPLYN
AVVWLDLRTQTTVEDLSKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNVRNVQKAVEEGRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKELC
DFFEIPMDLLPNVFSSSEIYGLIKTGALEGVPISGCLGDQCAALVGQMCFQEGQAKNTYGTGCFLLCNTGRKCVFSEHGLLTTVAYKLGREKPAYYALEGSVAIAGAVIR
WLRDNLGIIETSGDIERLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPLRHLQVDGGMTNNKVLMQLQAD
ILHIPVIKPFMPETTALGAAMAAGAAEGVSVWSLEPQALSVLRMERFEPQIQATESEIRYATWKKAVMKSMGWVTRQSPESGDPSIFSSLPLGFFIVSSMVMLIGARYIS
GVP*
24 >lcl|XP_003310507.1|Plus1complement(1402715..1404394) NW_003456976 putative glycerol kinase 3-like LOC740526 __SEG__ Chr4 {Pan troglodytes} MAASKKAVLGPLVGAVDQGTSSTRFLVFNSRTAELLSHHQVEIKQEFPREGWVEQDPKEILHCVYECIAKTCEKLGQLNIGISNIKAIGVSNQRETTVVWDKITGEPLYN
AVVWLELKTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLHWLLDNVRKVQKAVEGKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLC
EFFGIPMEILPHVRSSSEIYGLMEAGALEGVPISGCSGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTCHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIR
WLRDNLGIIKTSEEMEKLAKEVGTSYGSYFVPAFLGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFHIREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQAD
ILYIPVVKPLMPETTALGGFFPETTAMVAGAAEGVDVWRLEPEDLSAVTMERFEPQINAEESEICYSTWKKAVMKSMGWVTTQSPESGDPSVFCSLPLGFFIVSSMAMLI
RARYISGIP*
25 >lcl|XP_003311048.1|Plus1complement(1166940..1168277) NW_003457082 alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase MGAT1 __SEG__ Chr5 {Pan troglodytes} MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRPPSVSALDDDPASLTREVIRLAQDAEVELERQRGLLQQIGDALSSQRGRVPTAAPPAQPRVPVTPAPAVIPILV
IACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQAIASYGSAVTHIRQPDLSSIAVPPDHRKFQGYYKIARHYRWALGQVFRQFGFPAAVVVEDDLEVAPDFFE
YFQATYPLLKADPSLWCVSAWNDNGKEQMVDASRPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRQGRACIRPEISRTMTFGRKGVSHGQFFDQHLK
FIKLNQQFVHFTQLDLSYLQREAYDRDFLARVYGAPQLQVEKVRTNDRKELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPPTWEGY
DPSWN*
26 >lcl|XP_003311128.1|Plus16860286..6861251 NW_003457102 n-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, isoform B-like LOC100615707 __SEG__ Chr6 {Pan troglodytes} MPLSMRYLFIISVSSVIIFIVFSVFNFGGDPSFQRLNISDPLMLTQVCTSFINGKTRFLWKNKLMIHEKSSCKEYLTQSHYITAPLSKEEADFPLAYIMVIHHHFDTFAR
LFRAIYMPQNIYCVHVDEKATTEFKDAVEQLLSCFPNAFLASKMEPVVYGGISRLQADLNCIRDLSAFEVSWKYVINTCGQDFPLKTNKEIVQYLKGFKGKNITPGVLPP
AHAIGRTKYVHQEHLGKELSYVIRTTAMKPPPPHNLTIYFGSAYVALSREFANFVLHDPRAVDLLQWSKDTFSPDEHFWVTLNRIPGMYNSIFHAKEMCHI*
27 >lcl|XP_003311151.1|Plus16831292..6832233 NW_003457102 n-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, isoform A-like isoform 1 LOC100609905 __SEG__ Chr6 {Pan troglodytes} MMGSWKHCLFSVSLISALIFVFVYNTELWENKRFLRAALSNASLLAEACHQIFEGKVFYPTENALKTTLDEATCYEYMVQSHYVTETLSEEEAGFPLAYTVTIHKDFGTF
ERLFRAIYMPQNVYCVHLDQKATDAFKGAVKQLLSCFPNAFLASKKESVVYGGISRLQADLNCLEDLVASEVPWKYVINTCGQDFPLKTNREIVQYLKGFKGKNITPGVL
PPDHAVGRTKYVHQELLDHKNSYVIKTTKLKTPPPHDMVIYFGTAYVALTRDFANFVLQDQLALDLLSWSKDTYSPDEHFWVTLNRIPGMYVS*
28 >lcl|XP_003311373.1|Plus1complement(5866943..5868196) NW_003457120 phosphoglycerate kinase 2 isoform 1 PGK2 __SEG__ Chr6 {Pan troglodytes} MSLSKKLTLDKLDVRGKRVIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGAKAVVLMSHLGRPDGVPMPDKYSLAPVAVELKSLLGKDVLFLKDCVGAEVEKACAN
PAPGSVILLENLRFHVEEEGKGQDPSGKKIKAEPDKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVHLPHKASGFLMKKELDYFAKALENPVRPFLAILGGAKVADK
IQLIKNMLDKVNEMIIGGGMAYTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQ
ARLIVWNGPLGVFEWDAFAKGTKALMDEIVKATSKGCITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNI*
29 >lcl|XP_003312163.1|Plus18252746..8254032 NW_003457452 beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase GCNT1 __SEG__ Chr9 {Pan troglodytes} MLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEFVSVRHLELAGENPSSDINCTKVLQGDVNEIQKVKLEILTVKFKKRPRWTPDNYINMTSDCSSFIKRRKYI
VEPLSKEEAEFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASCFSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMD
FPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKFMEWAQDTYSPDEYLWATIQRIP
EVPGSLSASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDMDVDLFAIQCLDEHLRHKALETLKH*
30 >lcl|XP_003312988.1|Plus113854005..13854631 NW_003457668 glycolipid transfer protein-like GLTP __SEG__ Chr11 {Pan troglodytes} MALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISSNITKIKAVYDTNPAKFRTLQNILEVEKEMYGAERPKVGATLALMWLKRGLRFIQVFLQS
ICNEERDENHPNLIRVNATKAYEMALMKYHGWIVQIFQAALHAASCKSDLLKALSKGQNVTEEECLEKIRLFLVNYMATIDVIYERYTQMNAELNYKV*
31 >lcl|XP_003313716.1|Plus1complement(870375..871727) NW_003457726 major facilitator superfamily domain-containing protein 5 isoform 2 MFSD5 __SEG__ Chr12 {Pan troglodytes} MLVTAYLAFVGLLASCLGLELSRCRAKPPGRACSNPSFLRFQLDFYQVYFLALAADWLQAPYLYKLYQHYYFLEGQIAILYVCGLASTVLFGLVASSLVDWLGRKNSCVL
FSLTYSLCCLTKLSQDYFVLLVGRALGGLSTALLFSAFEAWYIHEHVERHDFPAEWIPATFARAAFWNHVLAVVAGVAAEAVASWIGLGPVAPFVAAIPLLALAGSLALR
NWGENYDRQRAFSRTCAGGLRCLLSDRRVLLLGTIQALFESVIFIFVFLWTPVLDPHGAPLGIIFSSFMAASLLGSSLYRIATSKRYHLQPMHLLSLAVLIVVFSLFMLT
FSTSPGQESPVESFIAFLLIELACGLYFPSMSFLRRKVIPETEQAGVLNWFRVPLHLLACLGLLVLHDSDRKTGTRNMFSICSAVMVMALLAVVGLFTVVRHDAELRVPS
PTEEPYAPEL*
32 >lcl|XP_003314352.1|Plus115062438..15063781 NW_003457847 alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase isoform 1 MGAT2 __SEG__ Chr14 {Pan troglodytes} MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNEALAPPLLDAEPARGAGGRGGDHPSVAVGIRRVSNVSAAPLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKA
GTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAGVNFCPVLQVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFG
HYREAKFSQTKHHWWWKLHFVWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSFYGMADKVDVKTWKSTEHNMGLALTRNAYQK
LIECTDTFCTYDDYNWDWTLQYLTVSCLPKFWKVLVPQVPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTVVAISPPRKNGGWGDIRDHELC
KSYRRLQ*
33 >lcl|XP_003317654.1|Plus182168..82455 NW_003459111 chondroitin sulfate N-acetylgalactosaminyltransferase 2-like LOC738448 __SEG__ ChrX {Pan troglodytes} FDMEVKGWGGEDVHLYRKYLRGDLIVIRNPVPGLFHLWHEKRCADELTPEQYRMCIQSKAMDEASRSHLGMLVFREEIDTHLHKQAYRTNSEAVG*
34 >lcl|XP_003317707.1|Plus1complement(427456..428412) NW_003459171 c1GALT1-specific chaperone 1 isoform 1 C1GALT1C1 __SEG__ ChrX {Pan troglodytes} MLSESSSFLKGVMLGSIFCALITMLGHIRIGHGNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFES
INMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKRLNSLLNIPEKCPEQGGMIWKISED
KQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHIFNDALVFLPPNGSDND*
35 >lcl|XP_003317974.1|Plus1complement(5736..5897) NW_003469224 alpha-(1,3)-fucosyltransferase-like LOC100609596 __SEG__ Chr9 {Pan troglodytes} MNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA*
36 >lcl|XP_003318253.1|Plus1complement(3257388..3258401) NW_003456883 CMP-sialic acid transporter-like LOC470865 __SEG__ Chr3 {Pan troglodytes} MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSAGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALS
NLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFMLCAGVMLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIIV
TLAGVYLSDGAEIKEKGFFYGYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVILFGLQITLTFALGTLLVCISIYLYGLPRQDTTSIQQGETAS
KERVIGV*
37 >lcl|XP_003339154.1|Plus11118964..1119938 NW_003457059 probable UDP-sugar transporter protein SLC35A4 SLC35A4 __SEG__ Chr5 {Pan troglodytes} MSVEDGGMPGLGRPRQARWTLMLLLSTAMYGAHAPLLALCHVDGRVPFRPSSAVLLTELTKLLLCAFSLLVGWQAWPQGAPPWRQAAPFALSALLYGANNNLVIYLQRYM
DPSTYQVLSNLKIGSTAVLYCLCLRHRLSVRQGLALLLLMAAGACYAAGGLQVPGNTLPSPPPAAAASPMPLHITPLGLLLLILYCLISGLSSVYTELLMKRQRLPLALQ
NLFLYTFGVLLNLGLHAGGGSGPGLLEGFSGWAALVVLSQALNGLLMSAVMKHGSSITRLFVVSCSLVVNAVLSAVLLRLQLTAAFFLATLLIGLAMRLYYGSR*
38 >lcl|XP_508010.2|Plus115570532..15571218 NW_003457620 ribulose-phosphate 3-epimerase isoform 2 LOC450708 __SEG__ Chr10 {Pan troglodytes} MASGCKIGPSILNSDLANLGAECLQMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAEANQYTFHLEATENPGTLIKDIRE
NGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGEQKFMEDMMPKVHWLRTQFPSLDIEGDGGVGSDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEA
AQKRSLDR*
39 >lcl|XP_513707.1|Plus197083..98072 NW_003456456 beta-1,3-galactosyltransferase 6 B3GALT6 __SEG__ Chr1 {Pan troglodytes} MKLLRRAWRRRAALGLGALALCGAALLYLARCAAEPGDPRAMSGRSPPPPAPARAPAFLAVLVASAPSAAERRSVIRSTWLARRGAPGDVWARFAVGTAGLGAEERRALE
REQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDSFARLDALLAELRARDPARRRRLYWGFFSGRGRVKPGGRWREAAWQLCDYYLPYALGGGYVL
SADLVHYLRLSRDYLRAWHSEDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKREVQLRLSYVYDWSAPPSQCCQRREGIP*
40 >lcl|XP_516853.1|Plus1complement(15546547..15547638) NW_003456894 UDP-GalNAc:beta-1, 3-N-acetylgalactosaminyltransferase 1 isoform 2 B3GALNT1 __SEG__ Chr3 {Pan troglodytes} MSFENVFSVWNINPIFDNSSRTFGSRASELLWMASALWTVLPSRMSLRSLKWSLLLLSLLSFFVMWYLSLPHYNVIERVNWMYFYEYEPIYRQDFHFTLREHSNCSHQNP
FLVILVTSHPSDVKARQAIRVTWGEKKSWWGYEVLTFFLLGQEAEKEDKMLALSLEDEHLLYGDIIRQDFLDTYNNLALKTIMAFRWVTEFCPSAKYVMKTDTDVFINTG
NLVKYLLNLNHSEKFFTGYPLIDNYSYRGFYQKTHISYQEYPFKVFPPYCSGLGYIMSRDLVPRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLD
VCQLRRVIAAHGFSSKEIITFWQVMLRNTTCHY*
41 >lcl|XP_517516.2|Plus1complement(769576..771453) NW_003456990 transketolase-like 2 TKTL2 __SEG__ Chr4 {Pan troglodytes} MANDAKPDVKTVQVLRDTANRLRIHSIRATCASGSGQLTSCCSAAEVVSVLFFHTMKYKQTDPEHPDNDRFILSRGHAAPILYAAWVEVGDISESDLLNLRKLHSDLERH
PTPRLPFVDVATGSLGQGLGAACGMAYTGKYLDKASYRVFCLMGDGESSEGSVWEAFAFASHYNLDNLVAVFDVNRLGQSGPAPLEHGADIYQNCCEAFGWNTYLVDGHD
VEALCQAFWQASQVKNKPTAIVAKTFKGRGIPNIEDAENWHGKPVPKERADAIVKLIESQIQTNENLIPKSPVEDSPQISITDIKMTSPPAYKVGDKIATQKTYGLALAK
LGRANERVIVLSGDTMNSTFSEIFRKEHPERFIECIIAEQNMVSVALGCATRGRTIAFAGAFAAFFTRAFDQLRMGAISQANINLIGSHCGVSTGEDGVSQMALEDLAMF
RSIPNCTVFYPSDAISTEHAIYLAANTKGMCFIRTSQPETAVIYTPQENFEIGQAKVVRHSVNDKVTVIGAGVTLHEALAAADHLSQQGISVRVIDPFTIKPLDAATIIS
SAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRGKTSELLDMFGISTRYIIAAVTLTLMK*
42 >lcl|XP_517702.2|Plus15822643..5824004 NW_003457016 beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 GCNT4 __SEG__ Chr5 {Pan troglodytes} MKIFKCYFKHTLQQKVFILFLTLWLLSLLKLLNVRRLFPQKDIYLVEYSLSTSPFVRNRYTHVKDEVRYEVNCSGIYEQEPLEIGKSLEIRRRDIIDLEDDDVVAMTSDC
DIYQTLRGYAQKLVSKEEKSFPIAYSLVVHKDAIMVERLIHAIYNQHNIYCIHYDRKAPDTFKVAMNNLAKCFSNIFIASKLEAVEYAHISRLQADLNCLSDLLKSSIQW
KYVINLCGQDFPLKSNFELVSELKKLNGANMLETVKPPNSKLERFTYHHELRRVPYEYVKLPIRTNISKEAPPHNIQIFVGSAYFVLSQAFVKYIFNNSIVQDFFAWSKD
TYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGFFYPGCTGSHLRSVCIYGAAELRWLIKDGHWFANKFDSKVDPILIKCLAEKLEEQQRDWITLSS
EKLFMDRNLTTTS*
43 >lcl|XP_522649.2|Plus12384669..2385676 NW_003457786 glyceraldehyde-3-phosphate dehydrogenase-like LOC467251 __SEG__ Chr13 {Pan troglodytes} MVKVKARVDRFGHVRCLVTRAAFNSAKVDIVAINDPFIDLNYMVYMFQYGSTHGKFHGTVKAENRKLVITGNLITIFQERDPSKIKWGDAGTEYIVESTSIFTIMEKSGA
HLQGGAKRVILSAPSANTPMFVMGMTHENYDSSLKIISNASCTMNCLAPLAKVIRDNSGIMEGLMTTVHAVPATQKTVDGPSRRLWCDSHGALQNIIPAPSDAAKAVAKV
IPELNGKLTGMAFCVPTANLSVVDLTCCLEKPAKYDDIKKVVKQVSEGPLKGILGYTEYQLVSSDFNSDTHSSTFDAGASIALNDHFFKLISWYDNEFGYSNRVMDLMAH
MSSKE*
44 >lcl|XP_524276.1|Plus1complement(924313..925506) NW_003458504 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 B3GNT8 __SEG__ Chr19 {Pan troglodytes} MRCPKCLLCLSALLTLLGLKVYIEWTSESRLSKAYPSPRGTPPSPTPANPEPTLPANLSTRLGQTVPLPFAYWNQQQWRLGSLPSGDSTETGGCQAWGAAAATEIPDFAS
YPKDLRRFLLSAACRSFPQWLPGGGGGQVSSCSDTDVPYLLLAVKSEPGRFAERQAVRETWGSPAPGIRLLFLLGSPVGEAGPDLDSLVAWESRRYSDLLLWDFLDVPFN
QTLKDLLLLAWLGRHCPTVSFVLRAQDDAFVHTPALLAHLRALPPASARSLYLGEVFTQAMPLRKPGGPFYVPESFFEGGYPAYASGGGYIIAGRLAPWLLRAAARVAPF
PFEDVYTGLCIRALGLVPQAHPGFLTAWPADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC*
45 >lcl|XP_525547.2|Plus1complement(698..832) NW_003457050 beta-glucuronidase-like LOC470163 __SEG__ Chr5 {Pan troglodytes} DPPLMFSEEYQRSLLEQYHLGLDQKRRKYVVGELIWNFADFMTNQ
46 >lcl|XP_528914.1|Plus1complement(1267802..1270300) NW_003458813 putative SMEK homolog 3-like isoform 2 LOC473543 __SEG__ ChrX {Pan troglodytes} MAGLRYSVKVYVLNEDEEWNNLGTGQISSTYDEQFQGMSLLVRSDSDGSVILRSQIPPDRPYGKYQETLIVWYEAENQGLVLKFQDPAGCQDIWKEICQAQGKDPSIQTA
VNISDEPEEDFNEMSVISNMVVLPDCELNTLDQIADIVTSVFSSPITDRERLAEILKNEAYIPKLLQLFHTCENLQNTEGLHHLYEIIKGILFLNEACLFEIMFSDECIM
DVVGCLEYDPALDQPKRHRDFLTNDAKFKEVIPITNSELRQKIHQTYRLQYIYDILLPVPSIFEDNFLSTLTTFIFSNKAEIVSMLQKDHKFLYEVFAQLKDETTHDDRR
CELLFFFKELCSFSQALQPQSKDALFETLIQLGVLPALKIVMIRDDLQVRSAAAVICAYLVEYSPSRIREFIISEAHVCKDSDLFINVIIKQMICDTEPELGGAVHLMVV
LHTLLDPRNMLTTPEKSERSEFLHFFYKHCMHKFTAPLLAATSQHNCEEDDIAGYDTSKNCPNDNQTAQLLALILELLTFCIQHHTFYIRSYILNKDLLRKALILMNSKH
THLILCVLRFMRRMICLNDEAYNNYIIKGNLFEPVVNALLDNGTRYNMLNSAILELFEYIRVENIKSLVSHIVEKFYNTLESIEYVQTFKGLKIKYENERDRQSQIQKNL
HSVLENIVVFRGTIEEIGLEEEICFMEDAGEAVMPPLEDDDEFMETKRTQEGEAVMPPLEDDDKFTETKRTHQEGEAVMPPLEDDDEFMETKRTQEHEDKVDSPKRTSSG
DFKFSSSYSACAAIGTGSPSGSSVVRLVDHPDDEEEKEEDEEEKEEDKEYETSPKKKPRLSS*