SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus G    

ID / Description / Sequence
1 >lcl|NP_001004150.1|Plus1complement(44343935..44345014) NT_039621 lactosylceramide 4-alpha-galactosyltransferase A4galt __SEG__ Chr15 {Mus musculus} MGISCSHLEETMSKPPDCLLRMLRGTPRQRVFTFFIISFKFMFLISILIYWHTVGAPKDQREYSLPVDFSCPQLAFPRVSAPGNIFFLETSDRTSPNFLFMCSVESAARA
HPESQVVVLMKGLPRDTTAQPRNLGISLLSCFPNVWIRPLDLQELFEDTPLAAWYSEARHRWEPYQLPVLSDASRIALLWKFGGIYLDTDFIVLKNLLNLTNTLGIQSRY
VLNGAFLAFERKHEFLALCLHDFVANYNGWIWGHQGPQLLTRVFKKWCSIQSLEKSHACRGVTALPPEAFYPIPWQNWKKYFEDISPEELTQLLNATYAVHVWNKKSQGT
HLEATSKALLAQLHARYCPTTHRAMKMYL*
2 >lcl|NP_001020559.1|Plus145206411..45207715 NT_039674 hypothetical protein LOC433182 Gm5506 __SEG__ Chr18 {Mus musculus} MSILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGVSQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTENKSKFGANA
ILGVSLAVCKAGAVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILEN
KEALELLKTAIAKAGYTDQVVIGMDVAASEFYRSGKYDLDFKSPDDPSRYITPDQLADLYKSFVQNYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAK
AASEKSCNCLLLKVNQIGSVTESLQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGSKAKFAGRSFRNPLAK*
3 >lcl|NP_001029052.2|Plus1complement(34759594..34762035) NT_039706 putative SMEK homolog 3 4930415L06Rik __SEG__ ChrX {Mus musculus} MTWPSEARPNINMEYRLHTVKVYVMMEDKQWKNVGTGQISSKYSEQLQGVCLLVHSLSDGSPIMECKIHPNVPYQKQQGKIIIWSEAKNHGMAIHFQEPNDCQEIWEDIC
QIQGKDPHVEITQELTDDLETFEHMPLIWNWVEMSNCEIHTLKNIAELFPFVFEMPSQKERLALFLENEGYIKKLLQLFHTCEKLKNMEGLYYLHNIIKGILFLNNTRLF
NIMFSDEFFMDIVGCLEYDPALDQPKQYREFLTQNSKFKEVIPIIHSQLRQKIQQTYRMQYVHDIMLPTPSIFQTNLLSDITTMIFFNKINIITMIQEDENFLLEVFSQL
KDNSIGDERRIELLLFLKEFCEFAKTLQSQKKNELLKTLIKLGIMSVLKVVVHMNDYQIQVGALDIFAYLVEYSPCLVRAYAMEEAQDSEDNDDLLINIMIKQMICDFDP
EFSQGIIMTAVLHELLNPENMRTTAKGCERKVFLNFFYKRYMRKLIAPILSIRVKYDSNDNRVYICPDNYQNAQLLGAVLEILTFCVQYHSMYIKHYIFSNNLLRSILVL
MSSKHTFLILCAVRFMRKIIGLKDKMYNHYIIKKNLFEPVVNAFMHNGHRYNMLNSAIIELFEFIRKENITSLIVNIVENFFRAFKSIEYVQTFKGLKTKYEEEKKRKSQ
RRKNLHSIMHPKMYYRHIEDMEVKVKADICCRGIIEEEERQGGGEEGAILPMGSDFTNNYDIFMKNKDTNESESAIEGQKIKSSEASECCPSHGDASATRMSRSHCSSLV
PLVDYLYDTDDENDDDPYGNDKHEDEHEDEDEEPPPKRPNLST*
4 >lcl|NP_001031817.1|Plus123413166..23414335 NT_039413 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 B3gnt8 __SEG__ Chr7 {Mus musculus} MRCRKCQLCLSALLTLLGLKVYIEWTSESWLKKAEPRGALPSPTPPNAEPTLPTNLSARLGQTGPLSSAYWNQQQRQLGVLPSTDCQTWGTVAASEILDFILYPQELRRF
LLSAACRSFPLWLPAGEGSPVASCSDKDVPYLLLAVKSEPGHFAARQAVRETWGSPVAGTRLLFLLGSPLGMGGPDLRSLVTWESRRYGDLLLWDFLDVPYNRTLKDLLL
LTWLSHHCPDVNFVLQVQDDAFVHIPALLEHLQTLPPTWARSLYLGEIFTQAKPLRKPGGPFYVPKTFFEGDYPAYASGGGYVISGRLAPWLLQAAARVAPFPFDDVYTG
FCFRALGLAPRAHPGFLTAWPAERTRDPCAVRGLLLVHPVSPQDTIWLWRHLWVPELQC*
5 >lcl|NP_001074636.1|Plus1complement(15942253..15943428) NT_039433 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6 B3gnt6 __SEG__ Chr7 {Mus musculus} MALPSSRRFKSPTTLAFFLVGVTLVVLNQWFLQEHRQEKAKGPVATRRSLAAVVQRSPLFQVPPCVANASANLLTGFQLLPARIQDFLRYRHCRRFPQLWDAPPKCAGPR
GVFLLLAVKSSPAHYERRELIRRTWGQERSYSGRQVLRLFLVGTSPPEEAAREPQLADLLSLEAREYGDVLQWDFSDTFLNLTLKHLHLLDWTAEHCPGVSFLLSCDDDV
FVHTANVLSFLEVQSPEHHLFTGQLMVGSVPVRESGSKYFVPPQIFPGVAYPAYCSGGGFLLSRYTVRNLRSAAHHVPLFPIDDAYMGMCLQQAGLAPSSHQGIRPFGVQ
LPNVQRLSLDPCMYRELLLVHRFAPYEMLLMWKALHNPALHCSHKQVAGSPTAGEQNPDAH*
6 >lcl|NP_001078980.1|Plus134582010..34584367 NT_039706 SMEK homolog 3, putative 4932429P05Rik __SEG__ ChrX {Mus musculus} MDDKLHSVKIYVMVEDEQWKGIGAGQISSKYIERLQGVCLIVQSESDGSLIMECKIHPNVPYHKQRGEIIIWSETKNHGMAIHFQEPNGCQEIWEDICQVQGKDPNVEIT
EELTDNLKTFEELLPIWNLVEMQNCELHTLENIADLFTFVHETPSHKERLVLVLEKGVYIKKLLQHFNTCEKLKNMESLYYLNNIIKGILFLDNTHLFNIMFSDEFFMDM
VGCLEYDPALDHPKQYREFLTQNAKFKEILPITHFQLRQTIQQTYRMQYVHDIVLPIPSICESNLLYGLNTMIIYNKIEIITMLQDDENFLLEVLARLKDNTVGNDRRHE
LLLFFKEFCTFAKTLENLEKHELLKTLINLGVMSALKAVVHMHDYQIQIAALDIFPYLVEYNPCLVREYLLDEAHDTDDDDLFLNIMIKQMICNSDPRFSQGIILPAILC
ALLDPENMHVTANGCEEKEFLNFFYTRCINNLIAPILSATVEKENANNRANICPDNYQNAQLLGVVIEILTFCVQYHSTYIKSYILDNNLLSRILVLMTSKHTFLILCAV
RFMRKLIGLKDEIYNLYIIKENLFEPVVNAFMHNGHRYNMLNSAIIELFEFIRQENIKSLIANIVENFFISFESIEYVQTFKGLKIKYEEEKNECQVRRNLLNVVCQKIY
CICTNDMGLKVKSDICHRRITETKEAILPNRRDFPSHYGIIMKIEETNESESAIEGQKIKSSEAFERCPSHGDASATRMSRSHCSSLVPLVNYPYDTDDENGDDPYGNDN
DEDEEPPQKRPNLSS*
7 >lcl|NP_001078984.1|Plus1complement(9894810..9896960) NT_166289 hypothetical protein LOC329828 AI464131 __SEG__ Chr4 {Mus musculus} MSQNLQETSQAYPRHRPGSHAGPKSLKVTPRATMYTFLPDNFSPAKPKPTKELRPLLCSAVLGLLLVLAAVVAWCYYSASLRKAERLRAELLDLNRGGFSIRNQKGEQVF
RLAFRSGALDLDSCSRDGALLGCSRAADGRPLHFFIQTVRPKDTVMCYRVRWEEAVPGRAVEHAMFLGDAAAHWYGGAEMRTQHWPIRLDGQQEPQPFVTSDVYSSDAAF
GGILERYWLSSRAAAIKVNDSVPFHLGWNSTERSMRLQARYHDTSYKPPAGRTAAPELSYRVCVGSDVTSIHKYMVRRYFNKPSRVPASEAFRDPIWSTWALHGRAVDQN
KVLQFAQQIRQHRFNSSHLEIDDMYTPAYGDFNFDEGKFPNASDMFRRLRDAGFRVTLWVHPFVNYNSSSFGEGVERELFVREPTGRLPALVRWWNGIGAVLDFTHPEAR
EWFQGHLRRLRLRYNVTSFKFDAGEVSYLPRDFSTYRPLSDPSVWSRRYTEMAEPFFSLAEVRVGYQSQNISCFFRLVDRDSVWGYDLGLRSLIPAVLTVSMLGYPFILP
DMIGGNAVPERTAGRQDGPGPERELYVRWLEVAAFMPAMQFSIPPWQYDAEVVAIAHKFAALRASLVAPLLLELAGEITDTGDPIVRPLWWIAPGDETAHRIDSQFLIGD
TLLVAPVLEPGKQERDVYLPAGKWRSYKGELFDKTPVLLTDYPVDLDEVAYFTWAS*
8 >lcl|NP_001159537.1|Plus14924802..4926169 NT_039590 glucosaminyl transferase 4, core 2 Gcnt4 __SEG__ Chr13 {Mus musculus} MKIFRCCFKYTLQQKLFILLLTLWLFSLLKLLNVGRLLFPQRDIYLVEYSLSTSPFVRNRFPESGDAARDNVNCSGVYEHEPLEIGKSLEIRRRSIIDLEDGDVVAMTSD
CDVYQTLRQYHEKLVSREEEDFPIAYSLVVHKDAIMVERLIRAIYNQHNLYCIHYDLKSPDTFKAAMNNLAKCFPNIFIASKLETVEYAHISRLQADWNCLSDLLKSSVQ
WKYVINLCGQDFPLKSNFELVTELKSLQGRNMLETVRPPSAKTERFTYHHELRQVPYDYMKLPVKTNVSKGAPPHNIQVFVGSAYFVLSRAFVKYIFNSSLVEDFFAWSK
DTYSPDEHFWATLIRIPGIPGGISSSSQDVSDLQSKTRLVKWFYYEGFLYPNCTGSHLRSVCIYGAAELRWLLNEGHWFANKFDSKVDPILMKCLAEKLEEQQRKLIALS
SEKFMTEGTRQSHTL*
9 >lcl|NP_034372.1|Plus1complement(1337616..1338917) NT_039472 alpha-(1,3)-fucosyltransferase Fut4 __SEG__ Chr9 {Mus musculus} MAPARQELQHESRCRPSRTVDAWRAAVATRGRHMETPGYRRRTRCGGWGLPRSVSSLAAVGLLCTALTTFICWGQLPPLPWASPAPQRLVGVLLWWEPFRGRGGYPKSPP
DCSLRFNISGCRLLTDRAAYGEAQAVLFHHRDLVKELHDWPPPWGARERTDKALVLRVFDDQEGAVTLTGKALETVGSRPPGQRWVWMNFESPSHTPGLRGLAKDLFNWT
LSYRTDSDVFVPYGFLYSRSDPTEQPSGLGPQLARKRGLVAWVVSNWNEHQARVRYYHQLSRHVSVDVFGRTGPGRPVPAIGLLHTVARYKFYLAFENSRHVDYITEKLW
RNAFLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPNAASLAAYLLFLDRNVAVYRRYFRWRRSFAVHITSFWDEQWCRTCQAVQTSGDQPKSIHNLADWFQR*
10 >lcl|NP_034373.1|Plus1complement(22546880..22547959) NT_039258 alpha-(1,3)-fucosyltransferase Fut9 __SEG__ Chr4 {Mus musculus} MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWVFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHH
RDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQ
AFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDFNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFW
ESHACLACDHVKRHQEYKSVGNLEKWFWN*
11 >lcl|NP_034395.2|Plus1complement(10515458..10516744) NT_039687 beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase Gcnt1 __SEG__ Chr19 {Mus musculus} MLRNLFRRRLFSCPTKYYFMLLVLSLITFSVLRIHQKPEFFSVRHLELAGDDPYSNVNCTKILQGDPEEIQKVKLEILTVQFKKRPRRTPHDYINMTRDCASFIRTRKYI
VEPLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASCFDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMD
FPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIP
EVPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKALENLEH*
12 >lcl|NP_034423.2|Plus149853376..49855025 NT_039674 glycerol kinase-like 1 Gykl1 __SEG__ Chr18 {Mus musculus} MAEAPKAVLGPLVGAVDQGTSSTRFLVFNPQTAELLCHHQVEIAQEFPKEGWVEQDPKAILQSVYECIEKACEKLGQQSIDISNIKAIGVTNQRETTIVWDKFTGEPLYN
AVVWLDLRTQSTVENLSKSISVSNNFVKNKTGLPISTYFSAVKLHWLIENVRKVQKAIEDGRAIFGTVDSWLIWCMTGGINGGVHCTDVSNASRTMLFNIHSLQWDEELC
DFFGIPMTILPRIRSSSEIYGLVKSGVLEGVPISGCLGDQSAALVGQLCLQDGQAKSTYGTGCFLLCNTGQKCVNSEHGLLTTVAYQLGRQEPVYYALEGSVAIAGAVVS
WIKNNLQIIQSSSEIEKLAEVAGTSYGCYFVPAFSGLYAPYWDPSARGIICGLTQFTNKFHIAFAALEAVCFQTREILDAMNSDCGIPLTHLQVDGGMTANRVLMQLQAD
ILCIPVMKPFMPETTALGVAMAAGAAEGVSVWSLDPKDLSSVQMEKFEPQINVEESEGRYATWKKAVLKSMGWVLTQSPDGRDPSIFSSLTLGFYVVSSMVILIGARYM*
13 >lcl|NP_034424.1|Plus1complement(21356453..21358117) NT_109320 glycerol kinase 2 Gk2 __SEG__ Chr5 {Mus musculus} MAASKQTSAGPLVGAVVQGTNSTRFLVFNSKTAELVCSHQVELTQEYPKEGWVEQDPKEILKSVYECIAKACEKLAEVNIDISNIKAIGVSNQRETTVVWDKFTGDPLYN
AVVWLDLRTQSTVETLTKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNLRPIQKAVEEGRAMFGTIDSWLIWCMTGGVNGGIHCTDVTNACRTMLFNIHSLEWDKDLC
DFFEIPMSILPNVCSSSEIYGLMTSGALEGVPISGCLGDQSAALVGQMCFHEGQAKNTYGTGCFLLCNTGQKCVFSEHGLLTTLAYKLGKNKPVFYALEGSVAIAGAVIR
WLRDNFEIITTSGEVENLAREVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTNNRILMQLQAD
ILHIPVVKSVMPETTALGAAMAAGAAEGVNVWSLEPEDLSTILMERYEPQIQATESEIRFSTWKRAVMKSMGWVTAKDPENGDNPVFSCLPLGFFIVSSMTLLIGARCVS
TAEE*
14 >lcl|NP_034924.3|Plus114579072..14580415 NT_096135 alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase Mgat1 __SEG__ Chr11 {Mus musculus} MLKKQTAGLVLWGAIIFVGWNALLLLFFWTRPAPGRLPSDSALGDDPASLTREVIHLAEDAEAELERQRGLLQQIKEHYALWRQRWRVPTVAPPAWPRVPVTPSPVQIPI
LVIACDRSTVRRCLDKLLHYRPSAERFPIIVSQDCGHEETAQVIASYGTAVTHIRQPDLSNIAVQPDHRKFQGYYKIARHYRWALGQIFNKFKFPAAVVVEDDLEVAPDF
FEYFQATYPLLRTDPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLADLWAELEPKWPKAFWDDWMRRPEQRKGRACIRPEISRTMTFGRKGVSHGQFFDQH
LKFIKLNQQFVPFTQLDLSYLQQEAYDRDFLAQVYGAPQLQVEKVRTNDQKELGEVRVQYTSRDSFKAFAKALGVMDDLKSGVPRAGYRGIVTFQFRGRRVHLAPPQTWT
GYDPSWN*
15 >lcl|NP_058584.3|Plus1complement(19735993..19737186) NT_039515 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 B3gnt2 __SEG__ Chr11 {Mus musculus} MSVGRRRVKLLGILMMANVFIYLIVEVSKNSSQDKNGKGGVIIPKEKFWKPPSTPRAYWNREQEKLNRWYNPILNRVANQTGELATSPNTSHLSYCEPDSTVMTAVTDFN
NLPDRFKDFLLYLRCRNYSLLIDQPKKCAKKPFLLLAIKSLIPHFARRQAIRESWGRETNVGNQTVVRVFLLGKTPPEDNHPDLSDMLKFESDKHQDILMWNYRDTFFNL
SLKEVLFLRWVSTSCPDAEFVFKGDDDVFVNTHHILNYLNSLSKSKAKDLFIGDVIHNAGPHRDKKLKYYIPEVFYTGVYPPYAGGGGFLYSGPLALRLYSATSRVHLYP
IDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKKNICSYIDLMLVHSRKPQEMIDIWSQLQSPNLKC*
16 >lcl|NP_062293.1|Plus1complement(198910..200025) NT_039662 beta-1,3-galactosyltransferase 4 B3galt4 __SEG__ Chr17 {Mus musculus} MPLSLFRRVLLAVLLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLISNSHACGGSGPPPFLLILVCTAPEHLNQRNAIRASWGAIREARGFRVQTLFL
LGKPRRQQLADLSSESAAHRDILQASFQDSYRNLTLKTLSGLNWVNKYCPMARYILKTDDDVYVNVPELVSELIQRGGPSEQWQKGKEAQEETTAIHEEHRGQAVPLLYL
GRVHWRVRPTRTPESRHHVSEELWPENWGPFPPYASGTGYVLSISAVQLILKVASRAPPLPLEDVFVGVSARRGGLAPTHCVKLAGATHYPLDRCCYGKFLLTSHKVDPW
QMQEAWKLVSGMNGERTAPFCSWLQGFLGTLRCRFIAWFSS*
17 >lcl|NP_062293.1|Plus1complement(198910..200025) NT_039662 beta-1,3-galactosyltransferase 4 B3galt4 __SEG__ Chr17 {Mus musculus} MPLSLFRRVLLAVLLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLISNSHACGGSGPPPFLLILVCTAPEHLNQRNAIRASWGAIREARGFRVQTLFL
LGKPRRQQLADLSSESAAHRDILQASFQDSYRNLTLKTLSGLNWVNKYCPMARYILKTDDDVYVNVPELVSELIQRGGPSEQWQKGKEAQEETTAIHEEHRGQAVPLLYL
GRVHWRVRPTRTPESRHHVSEELWPENWGPFPPYASGTGYVLSISAVQLILKVASRAPPLPLEDVFVGVSARRGGLAPTHCVKLAGATHYPLDRCCYGKFLLTSHKVDPW
QMQEAWKLVSGMNGERTAPFCSWLQGFLGTLRCRFIAWFSS*
18 >lcl|NP_062341.2|Plus125148228..25149769 NT_039305 glucose-6-phosphate 1-dehydrogenase 2 G6pd2 __SEG__ Chr5 {Mus musculus} MAEQVTLSRTQVCGILREELYQNDAFHQADTHIFIIMGASGDLAKKKIYPTIWWLFRDGLLPKETFIVGYARSQLTVDDIQKQSEPFFKATPEERPKLEEFFTRNSYVVG
QYDDPASYKHLNSYINALHQGMQANHLFYLALPPTVYEAVTKNIQETCMSQTGFNRIIVEKPFGRDLQSSNQLSNHISSLFREDQIYRIDHYLDKEMVQNLMVLRFANRI
FGPIWNGDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQSHLLQMLCLVAMEKPATTDSDDVRNEKVKVLKRISEVETDNVILGQYVGNPNGEGEAANGYLDDPTVPR
GSTTATFAAAVLYVKNERWDGVPFILRCGKALNERKAEVRLQFRDIPGDIFHQKCKRNELVIRMQPNEAVYTTMMTKKPGMFFNPEESELDLTYGNKYKNVKLPGAYERL
ILDVFCGCQMHFVRTDELREGWRIFTPLLHKIEREKPQPFPYVYGSRGPTEADELMRRVGFQYKGTYKGTHKH*
19 >lcl|NP_064409.3|Plus158149580..58150848 NT_078297 beta-1,3-galactosyltransferase 2 B3galt2 __SEG__ Chr1 {Mus musculus} MLQWRRRHCCFAKMTWSPKRSLLRTPLTGVLSLVFLFAMFLFFNHHDWLPGRPGFKENPVTYTFRGFRSTKSETNHSSLRTIWKEVAPQTLRPHTASNSSNTELSPQGVT
GLQNTLSANGSIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAEPGQIEARRAIRQTWGNETLAPGIQIIRVFLLGISIKLNGYLQHAIQEESRQYHDIIQQEY
LDTYYNLTIKTLMGMNWVATYCPHTPYVMKTDSDMFVNTEYLIHKLLKPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKV
SLGIRRLHLEDVYVGICLAKLRVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRKLH*
20 >lcl|NP_064410.1|Plus1complement(18761206..18762201) NT_039240 UDP-GalNAc:beta-1, 3-N-acetylgalactosaminyltransferase 1 B3galnt1 __SEG__ Chr3 {Mus musculus} MAPAVLTALPNRMSLRSLKWSLLLLSLLSFLVIWYLSLPHYNVIERVNWMYFYEYEPIYRQDFRFTLREHSNCSHQNPFLVILVTSRPSDVKARQAIRVTWGEKKSWWGY
EVLTFFLLGQQAEREDKTLALSLEDEHVLYGDIIRQDFLDTYNNLTLKTIMAFRWVMEFCPNAKYIMKTDTDVFINTGNLVKYLLNLNHSEKFFTGYPLIDNYSYRGFFH
KNHISYQEYPFKVFPPYCSGLGYIMSGDLVPRVYEMMSHVKPIKFEDVYVGICLNLLKVDIHIPEDTNLFFLYRIHLDVCQLRRVIAAHGFSSKEIITFWQVMLRNTTCH
Y*
21 >lcl|NP_064679.2|Plus18997302..8998282 NT_039207 beta-1,3-galactosyltransferase 1 B3galt1 __SEG__ Chr2 {Mus musculus} MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTFGNIRTRPINPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGI
KIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVINGGPIRDVRSKW
YMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVITVHQISPEEMHRIWNDMSSKKHLRC*
22 >lcl|NP_067525.1|Plus1complement(816503..817453) NT_039702 C1GALT1-specific chaperone 1 C1galt1c1 __SEG__ ChrX {Mus musculus} MLSESSSFLKGVMLGSIFCALITMLGHIRIGNRMHHHEHHHLQAPNKDDISKISEAERMELSKSFRVYCIVLVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESIN
MDTNDMWLMMRKAYKYAYDQYRDQYNWFFLARPTTFAVIENLKYFLLKKDQSQPFYLGHTVKSGDLEYVSVDGGIVLSIESMKRLNSLLSVPEKCPEQGGMIWKISEDKQ
LAVCLKYAGVFAENAEDADGKDVFNTKSVGLFIKEAMTNQPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHVFNDALVFLPPNGSEND*
23 >lcl|NP_080510.1|Plus116207957..16209228 NT_039185 GPI mannosyltransferase 1 Pigm __SEG__ Chr1 {Mus musculus} MSYPMHWGEWILNFRVPPAGVFGVAFLARVALVFYGVFQDRTLLVRYTDIDYHVFTDAARFVTEGRSPYLRATYRYTPLLSWLLTPNVYLSELFGKFLFISCDLLTAFLL
YRLLLLKGLGRRQACGYCVFWLLNPLPMAVSSRGNADSIVASLVLSTLYFIEKRLIACAAVFYGFAVHMKMYPVTYILPIALHLRPERDDDERLRQARFSFQARLYDFLR
RLCSWAVLLFVAVAGLTFVALSFGFYYKYGWEFLEHTYFYHLTRRDIRHNFSPYFYMLYLTAESKWSFTLGIAAFLPQFILLSAASFAYYRDLVFCCFLHTSIFVTFNKV
CTSQYFLWYLCLLPLVMPLVRMPWKRAVVLLLFWFIGQALWLAPAYVLEFQGKNTFLFIWLAGLFFLLINCSILIQIISHYKEDRLTERIKYD*
24 >lcl|NP_080680.2|Plus133841773..33842747 NT_039674 probable UDP-sugar transporter protein SLC35A4 Slc35a4 __SEG__ Chr18 {Mus musculus} MSVEDGGVPGLARPRQARWTLLLFLSTAMYGAHAPFLALCHVDGRVPFRPSSAVLLTELTKLLLCAFSLLVGWQTWPQGTPPWRQAVPFALSALLYGANNNLVIYLQRYM
DPSTYQVLSNLKIGSTALLYCLCLGHRLSARQGLALLLLMAAGACYASGGFQEPVNTLPGPASAAGAHPMPLHITPLGLLLLILYCLISGLSSVYTELIMKRQRLPLALQ
NLFLYTFGVILNFGLYAGSGPGPGFLEGFSGWAVLVVLNQAVNGLLMSAVMKHGSSITRLFIVSCSLVVNAVLSAVLLQLQLTAIFFLAALLIGLAVCLYYGSP*
25 >lcl|NP_082363.2|Plus1complement(16302362..16303675) NT_039474 beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 Gcnt3 __SEG__ Chr9 {Mus musculus} MTSWQRLCWHYRLWTLGCYMLLAILALKLSLRLKCDFDAMDLDSEEFQSQYCRDLLYKTLKLPAKSSINCSGVIRGEQKAVTQALLNNLEIKKKQQLFTEADYLRMTADC
EHFKTKRKFIQVPLSKEEASFPIAYSMVVHEKIENFERLLRAVYTPQNVYCVHMDQKSSEPFKQAVRAIVSCFPNVFIASKLVSVVYASWSRVQADLNCMEDLLQSPVPW
KYLLNTCGTDFPIKTNAEMVKALKLLKGQNSMESEVPPPHKKSRWKYHYEVTDTLHMTSKRKTPPPNNLTMFTGNAYMVASRDFIEHVFSNSKARQLIEWVKDTYSPDEH
LWATLQRASWMPGSDPLHRKFDLSDMRAIARLTKWYDHEGDIENGAPYTSCSGIHQRAVCVYGSGDLHWILQNHHLLANKFDPKVDDNVLQCLEEYLRHKAIYGTEL*
26 >lcl|NP_083203.2|Plus11707173..1709056 NT_039462 transketolase-like protein 2 Tktl2 __SEG__ Chr8 {Mus musculus} MALARDAKLESDTFQVLQDVANRLRIHSIRATCACSSGHPTSCCSVAEIMAVLFFHTMRYKQADPEHPDNDRFVLSKGHAAPILYAVWVEVGRICESDLLNLRKIHCDLE
GHPTPRLSFVDVATGSLGQGLGAACGMAYTGKYFDKASYRVFCLMGDGESSEGSVWEALAFASHYNLDNLVAIFDVNRLGQSGTAPLEHCTAVYEKRCQAFGWNTYVVDG
HDVEALCQAFWKAAQVKNKPTALIAKTFKGRGIPNVEDAENWHGKPMPKDRADGIVKLIENRIQTNRNLTPKPPIEDSPRISMSNTKMTSLPVYKLGDMIATREAYGLAL
AKLGQSNQRVIVLDGDTKNSTFSEVFKKEHPERFIECFIAEQNMVSVALGCATRGRTIAFVSTFAAFLTRAFDQIRMGAISQTNINFVGSHCGVSVGEDGPSQMALEDLA
MFRSIPNCTVFYPSDAVSTEHAVYLAANTKGMCFIRTTRPKTAVIYTAEENFVIGQAKVIRQSAVDKVTVIGAGVTLHEALVAAEELSQQGIFIRVIDLFTIKPLDAVTI
IQSAKATGGQIITVEDHYREGGIGEAVCAAISREPDIVVRQLAVTEVPRSGKPSELLDMFGISARHIIAAVKDTVMK*
27 >lcl|NP_112467.2|Plus1complement(26538013..26539266) NT_039649 phosphoglycerate kinase 2 Pgk2 __SEG__ Chr17 {Mus musculus} MALSAKLTLDKVDLKGKRVIMRVDFNVPMKNNQITNNQRIKAAIPSIKHCLDNGAKSVVLMSHLGRPDGIPMPDKYSLEPVADELKSLLNKDVIFLKDCVGPEVEQACAN
PDNGSIILLENLRFHVEEEGKGKDSSGKKISADPAKVEAFQASLSKLGDVYVNDAFGTAHRAHSSTVGVNLPQKASGFLMKKELDYFSKALEKPERPFLAILGGAKVKDK
IQLIKNMLDKVNFMIIGGGMAYTFLKELKNMQIGASLFDEEGATIVKEIMEKAEKNGVKIVFPVDFVTGDKFDENAKVGQATIESGIPSGWMGLDCGPESIKINAQIVAQ
AKLIVWNGPIGVFEWDAFAKGTKALMDEVVKATSNGCVTIIGGGDTATCCAKWGTEDKVSHVSTGGGASLELLEGKILPGVEALSNM*
28 >lcl|NP_149161.1|Plus131241853..31242779 NT_039625 beta-1,3-galactosyltransferase 5 B3galt5 __SEG__ Chr16 {Mus musculus} MAHMKTRLVYASILMMGALCLYFSMDSFRELPFVFKKSHGKFLQIPDIDCKQKPPFLVLLVTSSHKQLAARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEEMDATTLE
SEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGYLTELLLKKNKTTRFFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFS
SDVAIQVYNVSESVPFIKLEDVFVGLCLAKLKIRPEELHTKQTFFPGGLRFSVCRFQKIVACHFMKPQDLLTYWQALENSKEQDCPAV*
29 >lcl|NP_536693.1|Plus1complement(9825870..9826847) NT_039268 beta-1,3-galactosyltransferase 6 B3galt6 __SEG__ Chr4 {Mus musculus} MKVFRRAWRHRVALGLGGLAFCGTTLLYLARCASEGETPSASGAARPRAKAFLAVLVASAPRAVERRTAVRSTWLAPERRGGPEDVWARFAVGTGGLGSEERRALELEQA
QHGDLLLLPALRDAYENLTAKVLAMLTWLDERVDFEFVLKADDDSFARLDAILVDLRAREPARRRRLYWGFFSGRGRVKPGGRWREAAWQLCDYYLPYALGGGYVLSADL
VHYLRLSREYLRAWHSEDVSLGTWLAPVDVQREHDPRFDTEYKSRGCNNQYLVTHKQSPEDMLEKQQMLLHEGRLCKHEVQLRLSYVYDWSAPPSQCCQRKEGVP*
30 >lcl|NP_598861.1|Plus163396630..63397982 NT_039621 major facilitator superfamily domain-containing protein 5 Mfsd5 __SEG__ Chr15 {Mus musculus} MLVTAYLSFVGLLASCLGLELSRCRARPPGRACSNPSFLQFQLDFYQVYFLALAADWLQAPYLYKLYQHYHFLEGQIAILYVCGLASTVLFGLVASSLVDWLGRKKSCVL
FSLTYSLCCITKLSQDYFVLLVGRALGGLSTALLFSAFEAWYIHEHVERHDFPAEWIPATFARAAFWNHVLAVAAGVAAEAVASWIGLGPVAPFVAAIPLLALTGALALR
NWGENYDRQRAFSKTCAGGLRCLLSDRRVLLLGVIQALFESVIFIFVFLWTPVLDPHGAPLGIVFSSFMAASLLGSSLYRIATSKRYHLQPMHLLSLAVLIVVFSLFMLT
FSTSPGQENPVESFIAFLLIELACGLYFPSMSFLRRKVIPETEQAGVLNWFRVPLHLLACLGLLVLHDSDRKTGTRNMFSICSAVMVTTLLAVAGLFTVVRHDAELRVPS
PTGEPYAPEL*
31 >lcl|NP_666147.1|Plus127610855..27612183 NT_039551 alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase Mgat2 __SEG__ Chr12 {Mus musculus} MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKSDALGPPLLDAEPVRGAGHLAVSVGIRRVSNESAAPLVPAVPRPEVDNLTLRYRSLVYQLNFDQMLRNVGNDGTWSP
GELVLVVQVHNRPEYLRLLIDSLRKAQGIQEVLVIFSHDFWSAEINSLISRVDFCPVLQVFFPFSIQLYPNEFPGSDPRDCPRDLKKNAALKLGCINAEYPDSFGHYREA
KFSQTKHHWWWKLHFVWERVKVLQDYTGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPGCDVLSLGTYTTIRSFYGIADKVDVKTWKSTEHNMGLALTRDAYQKLIECT
DTFCTYDDYNWDWTLQYLTLACLPKIWKVLVPQAPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNSNKQYLFPETLVIGEKFPMAAISPPRKNGGWGDIRDHELCKSYRR
LQ*
32 >lcl|NP_780458.2|Plus13480347..3481924 NT_039302 proactivator polypeptide-like 1 Psapl1 __SEG__ Chr5 {Mus musculus} MGTMLCALILWSGLLGAARASPISVPRECAKGSEVWCQDLQAAAKCRAVRHCQSAVWNKPTVKSLPCSVCQDVAAAAGNGVNPGATESDILTSVMKTCEWLPSQESSAKC
KWMVNNHSAAVLSMLSGAQETDLASVCTALTLCEPLQRHLAETTSERPLTQEDANEVMAPFLSNGALSFHPSQMPEGAVCHDCVQLISLLQDALESNLTLAEVTVQNQCQ
SMGPGLAALCENYIHRQFVPAKQTLQGLPPQEVCRKGGFCERESAHWLTRVAAVDGVPSLEMEMPRTNELQMQLGLTCDVCLNLVQELDKWLVTNSTEALISHTLERVCT
VVPEPLVQQCITLVDTYSPELVQLMSKVTPEKVCETIKLCGSKRRARSISRAVATTPSLPVDEENQGSFCQGCKRLLGMSSQNLDHKSTKRDILNAFKGGCRILPLPYVM
QCNRFVAEYEPVLIESLKFMMNPTDLCKKMGACHGPKTPLLGTDQCVMGPSFWCKSPEAAEMCNALEHCQRLVWKKPVSKINEQP*
33 >lcl|NP_849210.1|Plus1complement(32610809..32612008) NT_078575 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 B3gnt9-ps __SEG__ Chr8 {Mus musculus} MRRRRRPRLCPDAWLTLLLSAALGLLLYAQRDVASPTTRPPARGPQLPRPTPSLRARELPNTARAAPLAYEGDTPVPPTPTDPFDFGGYLRAKDQRRFPLLINQRRKCRS
DGASGGSPDLLIAVKSVAADFERREAVRQTWGAEGRVQGALVRRVFLLGVPKGAGSGGAGTRSHWRTLLEAESRAYADILLWAFEDTFFNLTLKEIHFLSWASAFCPDVH
FVFKGDADVFVHVRNLLQFLELRDPAQDLLAGDVIVQARPIRARASKYFIPRAVYGLPVYPAYAGGGGFVLSGATLRRLADACSQVELFPIDDVFLGMCLQRLRLTPEPH
PAFRTFGISQPSAAPHLRTFDPCFYRELVVVHGLSAADIWLMWRLLHGPQGPVCAHPQPVATGPFQWNS*
34 >lcl|NP_941013.2|Plus19974589..9975641 NT_078458 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 B3gnt4 __SEG__ Chr5 {Mus musculus} MLPRLGCVLFCSLVVLLLSCLLLLKERIPAGSSKAHQQFLALPRSHHSQCSPNLTVVNTSLSLPSRHRLFLTYRHCRNFSILLEPSECARDTFLLLVIKSQPAHIEQRSA
IRSTWGRAGSWARGRQLKLVFLLGVAGPVPPAQLLVYESWQFDDILQWDFAEDFFNLTLKELHVQRWIAAACTQAHFILKGDDDVFIHVPNVLEFLEGWDPAQDFLVGDV
IRLARPNRNTKVKYFIPFSMYRARHYPPYAGGGGYVMSQATVRHLHMAMEEAELFPIDDVFVGMCLRKLGVTPIHHAGFKTFGIQQPLNPRDPCLYKGLLLVHRLSPLEM
WTMWALVTDERLKCAATHKP*
35 >lcl|XP_001476757.1|Plus1396422..397423 NT_166349 glyceraldehyde-3-phosphate dehydrogenase-like isoform 2 LOC100042025 __SEG__ ChrY {Mus musculus} MVKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHL
KGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIP
ELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMA
SKE*
36 >lcl|XP_003084616.1|Plus1complement(12140959..12142218) NT_039260 fructose-bisphosphate aldolase A Aldoart1 __SEG__ Chr4 {Mus musculus} MATHRQDVSIFNMTRLSLAMAFSFPPDANEQPHSGLDNTHQQTKELGKESTTTGTMPCPYPALTTEQKKELSDIAHRIVAPGKGILAADESIGSMGNRLQSIGTENTEEN
RRFFRQLLLTADDRVNPCIGGVILFHETLYEKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGKHTPSPLAIM
ENANVLARYASICQQNGIVPIVEPEILPDGDHDLSCCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACTQKFSNEEIAMATVTALRRTVPPAVPGVTFLSGGQ
SEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKEENLKAAQEEYIKRALANSLACQGKYTPSGKTGATASESLFISNHAY*
37 >lcl|XP_111973.7|Plus133559319..33561718 NT_039706 putative SMEK homolog 3-like Smek3-ps __SEG__ ChrX {Mus musculus} MDNKLHKVKVYVMVEDKQWKDLGTGQISTKYIDGLQGMCLLVHSESDDSLIMECKIYPNVPYKKQEGDIIVLSEGKDHGLAIHFQEANGCQQIWEDICKVQGKDPNIELI
QEITDDLEGFENLMLQWNQVEIPNSKVSTVANIINFFKLVSEMPSLKERLVLVLENDGYIKKLLQLFDTCEKKLNIEGLQYLNSIIKGILFLNDTRLFKIMCSDEFFMDV
VGCLEYDPDSDQPKRHREFLTQNVKFKDIIPITQSQLRQKIQQTYRMQYVYDIVLPTPSIVEANLLSDLTTMIFFNKIEIITMLQEDENFLLEIFAQLKDNTVCDERRHE
LLLFFKEFCAFAEILESQEKNALIKTLIKLGIMNALKVIVHMHDNQIQIAALDIFAYLAEYNPQVVQAYSMEEAQDSEDNDDLLINIMIKKMICDSDPEFSQGIILPVVL
HALLDPENMPVTSNGYERKGFLNFFYTHCISNLTAPILSTTVENDIDHNRANICPDDYQNAQLLEVILEILTFCVQCHSMYIKKYILSNNLLSRILVLMNSKHTFLILCA
LRFMRKMIGLKDETYNLYIIKNNLFEPVVNVFMCNGTRYNMLNSAIIELFEFIRQENIKTLIVNIVENFFIAFESIEYVQTFKGLKTKYEEDKKRESLIQKYLDNMIYPK
ICYRHIKTMEVNVKEDICCKGITEEEKEKDGRGGGAIIQIGSEFPNNYDILMKIKETSERENELECPKRKSCEASKFSPSQGDNSDNGMSTVHCSSLVALVDYPYDTDGD
DDSDPYDNDENKNENEGEEPPQKRPNLSL*