SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom G    

ID / Description / Sequence
1 >lcl|XP_001362377.1|Plus15238742..5239743 NW_001581971 glyceraldehyde-3-phosphate dehydrogenase-like LOC100010451 __SEG__ Chr5 {Monodelphis domestica} MVKVGINGFGRIGRLVARVAFTTNKVEIVAINDPFLDVNCMAYLLKFDSTHGKFNGTVKPENEKLNVNGRSIAVYQEKDPAKIKWSTAGADYVLESTGAFTTMEKAKAHL
NGGCKRVIISAPSDDAPMYVMGVNHETYNNSHTVVSNASCTTNCLAPIAKVLHENFGIVEGLMTTIHAITATQKTVDGPSGKKWRDGRGAGQNIIPAATGAAKAVGKVLP
ELNGKLTGMAFRVPVPNVSVVDLTCRLEKPTKYEDIKRVMKNASEGYLKGILGYTEEQVVSTDFIGDPNSSIFDAEAGIALNDYFVKIISWYDNEYGYSNRLVDLIAYMS
TKE*
2 >lcl|XP_001362939.1|Plus1complement(4914454..4915938) NW_001581836 UDP-glucose 6-dehydrogenase-like LOC100010848 __SEG__ Chr1 {Monodelphis domestica} MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSATLPIYEPGLKEVVESCRGTNLFFSTDIDAAIKEADLVFISVNTPTKTYGMGKGRAADLKYIE
ACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDWVLIGGDETPEGQKAVCALSAVYEHWVPKEKILTTNTWSSELSK
LAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKATVGFGGSCFQKDVLNLVYLCEALNLPEVARYWQQVIDMNDYQRRRFASRIIDSLFNTVTDKK
IAILGFAFKKDTGDTRESSSIYISKYLMDEGAHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTITKDPYEACDGAHAVVICTEWDVFKELDYERIHKKMLKPAFIFD
GRRVLDDLHSELQTIGFQIETIGKKVSSKRIPYAPSSEIPKFSLQDPPNKKPRV*
3 >lcl|XP_001363417.1|Plus1complement(1619189..1620142) NW_001587043 c1GALT1-specific chaperone 1-like LOC100012412 __SEG__ ChrX {Monodelphis domestica} MLFESSSFLKGMMLGSIFCALVTMLGHIRIGHENISHHEHHHLQALSKEDFLKISEAERMELVKSVRVYCMILVKPKDVGRWAAVKDTWTKHCDKVEFFCTESIKVFESI
NLETNDMWTMMRKAYRYAYDNYKDEYNWFFLARPTTFAVIENLKFFLLKRDATQPFYIGHTIKYGELEYVDIEGGIVLSIESMKRLKQLLSDPQKCPEQGSMIWKVSEDK
QLAICLKYSGVFAENAEDSEGKDVFNIKSIGFLIKEAMSNNPQKVVEGCCSDMAVTFNDLAPNQMHVMMYGVYRLRAYGHTFHDALVFLPPNGSDND*
4 >lcl|XP_001363713.1|Plus116549653..16550654 NW_001581976 glyceraldehyde-3-phosphate dehydrogenase-like LOC100013593 __SEG__ Chr6 {Monodelphis domestica} MVKVGINGFGRIGRLVTRAAINSGKVDIVAINDPFLDVNYMIYLFIYDSTHGKFKGSVTAEKGKMVINGKAITIFQERDPTNIKWKDAGALYVVESTGVFTTIEKASTHL
KGGAKRVIISAPSADAPMFVMGVNHETYENTLQVVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAGQNIIPAATGAAKAVGKVIP
DLNGKLTGMAFRVPIPDVSVVDLTCRLEKPAKYEDIKQAIKKASEGPLKGILGYTEEQVVSSDFITDTHSSTFDAEAGISLNDHFVKLISWYDNEYGYSNRVVDLMEYMA
TKE*
5 >lcl|XP_001364124.1|Plus119513588..19514457 NW_001581968 glucosamine-6-phosphate isomerase 1-like LOC100012448 __SEG__ Chr5 {Monodelphis domestica} MKLIILDNKPQACEWAAKYIRNRIILFSPGPDKYFTLGLPTGNTPMGCYKKLIEYYNNGDLSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNLFKHIDIHPENTHILDGN
AADLQAECDAYEEKIKAAGGIELFLGGIGYHGHIAFNEPGSSLVSRTRVKTLAMDTILANARFFNGDLSKVPKLALTVGVGTVMDAREVMILITGAKKAFALYKVTEEGV
SHMWTVSAFQQHPRTIFVCDEDATLELKVKTVKYFKGLMLVHNKLVEPLYSIKEKETEKSQPAKKPYSD*
6 >lcl|XP_001364234.1|Plus1591842..592672 NW_001581860 putative hydroxypyruvate isomerase-like LOC100010795 __SEG__ Chr1 {Monodelphis domestica} MAPLRFAANLSWLFSEQGPALSARLEAAARAGFRAVEVAWPYTEPAAPLAAAARAAGLQLVLLNTPPGSADLGELGLGAVPGRQDAFREGLELAVAYARELGCPQVHLMA
GRVPQGAERAAVAKDMDAVFVENLRHAADVLARENLVGLLEPINTRLTDPRYFLDTPEQAATILRRVDRPNLRLQLDVFHWQIMGGNLTANIRTFLPLVGHVQVAQVPDR
GEPDSLGEINFPYLFQLLEELGYVGFVGCEYRPRGDTQEGLSWLRAYWESRGLAPA*
7 >lcl|XP_001364424.1|Plus1complement(4461365..4462360) NW_001581897 glyceraldehyde-3-phosphate dehydrogenase-like LOC100013473 __SEG__ Chr3 {Monodelphis domestica} MVKVGVNGFGCTGRLVTRAAFNSSGVVAINDPFIDHAYMVYMFQYDSTHGNFKGTGKAENGKLMINGKPIIIFQERDPANIKWGDAGLEYVVESTGIFTAMEKARAHLKC
GAKHVIISALSADAPMFVMGMNKEKYDNSLKIISNASFTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTGDGPSGKLWRDGHGAAQNIIPASTNAAKAVGKVIPEL
NGKLTGMAFRVPTPNVSVVDLTCHLEKAAKYDDIKKVVKQASEGSLKGILGYTEDQVVSCDFNSDTHSSIFDAGAGIALNDHFVKLISWYDNEYSYSHHIVDLMMYMATK
E*
8 >lcl|XP_001364949.1|Plus14874024..4875685 NW_001587038 glycerol kinase-like LOC100016814 __SEG__ ChrX {Monodelphis domestica} MAAAKKTVLGPLIGAIDQGTSSTRFLVFNSKTSELLSHHQFELKQKFPKEGWVEQDPKEILLSVYECVEKTCEKLIQLNVDISNIKAIGVSNQRETTVIWDKFTGEPLYN
AVVWLDLRTQSTVETLSKRIPGNNNFVKSKTGLPLSTYFSAVKLHWLLENVRKVKKAVEEQRALFGTIDSWLIWNLTGGTTGGVHCTDVTNASRTMLFNIHSLEWDPELC
EFFDVPMEILPDVRSSSEIYGLMKSGSLEGVPLSGCLGDQSAALVGQMCFQEGQAKNTYGTGCFLLCNTGPKCVFSEHGLLTTVAYKLGRDKPVCYALEGSVAIAGAVVR
WLKDNLGIIKTVPEIEKLAEEAGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKQHIAFAALEAVCFQTREILDAMNKDCGMPLTHLQADGGMTTNRILMQLQAD
ILYIPVVKPSMPETTALGAAMAAGYAEGVGVWSLEPEDLSVVTMERFEPQINAEESEIRYATWKKAVQKSMGWVTSQTPLLGDSNIFCSIPLGFYIVSSMVMLIGARYIS
GIP*
9 >lcl|XP_001365416.1|Plus1complement(38843651..38844904) NW_001581968 phosphoglycerate kinase 1-like LOC100014733 __SEG__ Chr5 {Monodelphis domestica} MSLSNKLTLDKMDLKGKRVIMRVDFNVPMKNKEITNNQRIKAALPSINYCLDNGAKSVVLMSHLGRPDGIPMPEKYSLEPVAMELKSLLGKDVLFLKDCVGPEVEKACAD
PPNGFIILLENLRFHVEEEGKGKDASGNKIKADPANVEAFQASLSKLGDIYVNDAFGTAHRAHSSMVGVNLPQKASGFLMKKELTYFAKALESPERPFLAILGGAKVADK
IQLINNMLDKVNEMIIGGGMGFTFLKVLNNMEIGTSLFDEEGAKIVKDLMAKAEKNGVKITLPVDFVTADKFDENAKTGQATLASGIPAGWMGLDCGPESSKKYAEAVAR
AKQIVWNGPVGVFEWESFARGTKELMNNVVEATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVAALSNI*
10 >lcl|XP_001365935.1|Plus11351701..1352750 NW_001581903 beta-1,3-galactosyltransferase 2-like LOC100011820 __SEG__ Chr3 {Monodelphis domestica} MKLIRERLGLRVLLSTALGGLLILLVGQLLDSRTSSMDLGPLVPTELTGDTLSTLRKFEWQARTPHPLDPRYPYPYPFLLNHPNKCEGPKGTPFLLMLVMTQPQDVGVRQ
AIRETWGNETSVPGVVIRRLFVLGLPPPLFTKELRILLEEEDMEHGDLLQVGFLDTYNNLTLKVLMGLEWMAQHCSTARYVLKVDGDVFLNPSFLVQQLLQPNGPPRPDF
ITGYIYRDTGPLRSPDYKWYMPPELYSQDKYPPYCGGPGYVLSVPLALRVLAVAQTIKVIYLEDVFIGLCLHQLGVKPTPPPPQTFLMYPIEYEHCTFHRLALVHQFQSQ
ELLRIWPDFQTGNITCPVA*
11 >lcl|XP_001365994.2|Plus11389873..1390901 NW_001581903 beta-1,3-galactosyltransferase 2-like LOC100011867 __SEG__ Chr3 {Monodelphis domestica} MKLIRRRLVLGALLGTVFLGLLVLLVGQLLESWTSSTNLRPPSPKISLRKFEWQAWTPHPLDLNYPYPYPFLINHPDKCKGPRGAPFLLMLVMTQPHEVGVRQVIRQTWG
NETLIPGVVICRLFVLGLPRPIFAQEIQVLLEEEDREYGDLLQVGFLDTYRNLTLKVLMGLEWMAHYCPTARYVLKVDNDVFLNPSFLVHQLLHPNQPPQPNFITGHIYT
DSEPQRSLEDKWYMPPELYPQEKYPVYCGGPGYVLSVSLALRVLTVAQRLKAIYLEDVFIGLCIQELGVQPTPAPPDTFLIVRQEYEHCAFHQLALVHQYKPQELLQLWP
DFQAVNDTCPQE*
12 >lcl|XP_001366053.1|Plus11438087..1439121 NW_001581903 beta-1,3-galactosyltransferase 2-like LOC100011905 __SEG__ Chr3 {Monodelphis domestica} MRRQLVLQILLGSVFTGLLLLLADQQQGSWNSSMDLCPPSQKAPTKDPLDHSSRKFEWLTQTPHPFDLRYPYPYPFLINHPDKCEGPRGAPFLLMLVMTRPQDVGVRQAI
RQTWGNETLVPSVVVRRLFVLGLPPPLFDKELQALLEEEDREHGDLLQVGFLDTYRNLTLKVLMGLEWMAQHCPSAKYVLKVDSDVFLNPNFLIQHILQHNGPPRPNFIT
GHIYRNPNPERRQGLKWYMPPELYSQSKYPDYCAGPGYVLSGSLALRVLSVAQRVKAIYLEDVFVGFCLKHLGVKPVPAPPRTFLMVRRKYNHCAFQRLVLVHHFQHQEL
LHIWPDFLRANNTC*
13 >lcl|XP_001366128.1|Plus14101002..4102291 NW_001581979 beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase GCNT1 __SEG__ Chr6 {Monodelphis domestica} MVRRVLRRKLCSCHFKPFFLLLVFTLIICFSVLRNNQKDDFLNHRHLELTRENPYNNINCTKVILGDKEEIQNVKLTMLTVKFRNLPQWTNDDYINMTKDCAAFIKTRKY
IMEPLSKEEEEFPIAYSVVVYHKIEMLDRLLRTIYTPQNYYCIHVDKKSPESFLAAVKGIASCFNNVFIASQLENVVYASWSRVQADLNCMRDLYRQSSKWKYLINLCGM
DFPIKTNLEMIRKLKTLMDGNSLETEKMPSHKEVRWKNHYEVIEGKLKNTGKNKSRPPIESPIFSGSAYFVVSRKYVEYVLTNEKILKFIEWAKDTYSPDEYLWATIQRI
PEVPGSLSSSNKYDISDMQSVARFVKWQYLEGDIFKGAPYPPCNGIHVRSVCIFGVGDLKWMLQQPHFFANKFDISVDSFAVQCLEEHLRHKALYPTKQ*
14 >lcl|XP_001366179.1|Plus1complement(1478472..1479500) NW_001581903 beta-1,3-galactosyltransferase 2-like LOC100012002 __SEG__ Chr3 {Monodelphis domestica} MKLRKWNMVLWAVLSTAFLGLLVSFLSQLLASWTTPAYLSLPSPRISSRKFEWKIQTPHPFDLRYPYSYPFLINHPDKCEGPRGAPFLLMLVMTRPQDVGVRQAIRQTWG
NETLVPSVVVRRLFVLGLPPPLFDKELQALLEEEDREHGDLLQVGFLDTYRNLTLKVLMGLEWMAQHCPSAKYVLKVDSDVFLNPRFLLHQVLWPNGPSPPDFITGHINR
NTNPVRRLHTKWYMPPELYSQSKYPDYCVGPGYVLSGSLALRILTTAQHVKAIYLEDVFVGLCLRLLGVKPTPAPPNTFLMFRRKYNHCAFQRLVLVHQFQHQELLKIWP
DFLTSNAACPTV*
15 >lcl|XP_001367469.1|Plus1complement(32060754..32061431) NW_001581859 ribulose-phosphate 3-epimerase-like LOC100018804 __SEG__ Chr1 {Monodelphis domestica} MASGCKIGLSILSSDLACLGAECTRMLDSGTNYLHLDVMDGHCVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAIAEANQYTFHLEATENPGALIRENGM
KVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMLKVHWLRTQFPSLDIEVDGGVGPDTIHKCAEAGANMIVSGSAIMRSKDPRSVINLLRNVCSEAAQK
CSLDR*
16 >lcl|XP_001367560.1|Plus1complement(50404731..50405999) NW_001581868 beta-1,3-galactosyltransferase 2-like LOC100020032 __SEG__ Chr2 {Monodelphis domestica} MLQWRRRHCCFAKMTWNAKRSLFRTHLIGLLSLVFLFAMFLFFNHHDWLPGRAGFKENPVTYTIRGFRSTKGETNHSSLRNIWKDTVPQTLRPQTATNANNTDLSPQGVT
GLENTLSANGSIYNEKGTGHPNLYHFKYIINEPEKCQEKKPFLILLIAAEPGQAEARRAIRQTWGNESLAPGIQITRIFLLGLNVKLNGHLQRAILEESRQYHDIIQQEY
LDTYYNLTIKTLMGMNWVATYCPHIPYVMKTDSDMFVNTEYLIHKLLKPDLPPKHNYFTGYLMRGYAPNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKV
SLSIRRLHLEDVYVGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRKLH*
17 >lcl|XP_001367612.1|Plus170779935..70781014 NW_001581879 alpha-(1,3)-fucosyltransferase FUT9 __SEG__ Chr2 {Monodelphis domestica} MTSTSKGIFRPFLITCIILGCFMACLLIYIKPTNSWIFGPIETSSSVLKMKNFFSSKTDDLNETIILIWVWPFGQTFDLSSCQPMFNIHGCHLTTDRALYNKSHAVLIHH
RDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGSMKVSTNSLVFEVPSKKKLVCWVVSNWNPEHARVKYYSELSKSIEINTYGQ
AFGEYLNDKNLIPTISSCKFYLSFENSIHKDYITEKLYNALLAGTVPVVLGPSRENYENFIPGDSFIHVEDYSSASELAKYLKELDRNDKLYLSYFNWRKTFTVNLPRFW
ETHACLACDHVKRHQEYKSVGNLEKWFWN*
18 >lcl|XP_001367817.1|Plus18766715..8768058 NW_001581876 alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like LOC100019068 __SEG__ Chr2 {Monodelphis domestica} MLKKQSAGLVLWGAILFVAWNALLLFFFWARPLPGGPSSEDPFANDPASLSRRVIRLAQEAEIELERQHVLLQQIQKHSVLWNQRQQVATAGPPAVSHPTVAPTTFVLPI
LVIACDRSTVRRCLDKLLHYRPSAERFPIIVSQDCGHKVTAQVIASYGNAIMHIKQPDLSSIPVPTEHRKFQGYYKIARHYRWALNQVFRTFKYQAAVVVEDDLEVAPDF
FEYFQATYPLLRTDPSLWCVSAWNDNGKEQMVDAKRPDLLYRTDFFPGLGWLLLAELWDELEPKWPKAFWDDWMRQPEQRRDRACLRPEISRTMTFGRKGVSQGQFFDQH
LKFIKLNQGFVFFTQLDLSYLKQEAYDRDFSARVYAAPQVQVEELKSNQKQELGEVRVQYRGRDSFRAFAKALGVMDDLKSGVPRASYRGIVSFLFRGRRVYLAPPQDWT
GYDPSWS*
19 >lcl|XP_001368099.1|Plus1complement(3131092..3132507) NW_001581963 alpha-(1,3)-fucosyltransferase-like LOC100013730 __SEG__ Chr4 {Monodelphis domestica} MARGTHLPQAWSPGGGEPGVWHSESGRCPLPPQASQQEDELPRRARRRGELQQYESRYLSPLRVGLGRATAAAAPAYPPLPMFMRWLGQLRGRSGGREMPRIVWLLLAVG
LLFSGLVFYIYLGLLPPLPWASSRPLVSPHQVTVLMWWEPFSGSGRSSGPAPDCQRQFNVSGCRLITDRKYYWEAQAVLFHHRDLVGTQDWPPPRPEPNGIAARVVGISW
MGSQPARPPGQRWVWMNFESPTNSPKLGSFDSSLFNWTLTYRADSDIFVPYGYLYPRNSLHDPPAGLMPPMSRKQGLVAWVISHWNEKQARVRYYYELRRHVKVDVFGLR
GPGRLMPDIGLLHTVARYKFYLAFENSQHQDYITEKLWRNSLLAGAVPVVLGPSRANYERFVPRSAFIHVDDFPNASALAAYLHFLDRNLNMYKRYFDWRRRYAVHTLSF
WDEPWCRTCQVLQIAGDRPKKMYNLAAWFQR*
20 >lcl|XP_001368566.1|Plus1complement(51377536..51378222) NW_001581978 ribulose-phosphate 3-epimerase-like LOC100021737 __SEG__ Chr6 {Monodelphis domestica} MASGCKIGPSILNSDLACLGAECTWMLDSRADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAIAGANQYTFHLEATENPGALIKDIRE
NGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTIHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEA
AQKRSLDR*
21 >lcl|XP_001369222.1|Plus162708333..62709097 NW_001582021 phosphoglycerate mutase 1-like LOC100022730 __SEG__ Chr8 {Monodelphis domestica} MATYKLVLIRHGQSFWNLENRFSGWYDVDLSPVGHLEAQRCGQELRDAGYVFDICFTSIQKRAIRTLWIMLDVMDQMWLPVVRTWRLNERHHGELTGLNKAELAAKHGEA
QVKMWRRSYNIPPPPMEISHPFYSSITKDRRYADLTEGQVPSCESIKDSTARGLPFWNEEIFPRIREGKRVLVVAHCICLGGMVKYLEGLSEEAAMELNLPNCIPIVYEL
DKNMKPVKPMQFLGDEETLRKAIEAVAAQGKAQK*
22 >lcl|XP_001370737.1|Plus1complement(3003822..3004697) NW_001581956 beta-1,3-galactosyltransferase 5-like LOC100017059 __SEG__ Chr4 {Monodelphis domestica} MSSTEICILCIRKEGTILFKKHSGNFLQLPDIDCGKNPPFLIVMVTSSHNQVEARMAIRETWGRERSVNGKRIITYFLLGITSPKDDYVVTQESQKYRDIIQKDFLDVYF
NLTLKTMMGIEWVHHFCPQSDFVMKTDSDMFVNVYYLTELLLRKNRTTRFFTGFLKMNEFPIRRPFNKWYVSTYEYPWKKYPPFCSGTGYVFSSDIASDVYNVSEKVPFI
KLEDVFMGLCLAELKINLEELHSEQTFFPDGLEFSTCRFKKIVTCHFVKPSELLVYWKALERSLDEKCPAD*
23 >lcl|XP_001370815.1|Plus1complement(25064008..25065078) NW_001581902 fructose-1,6-bisphosphatase 1-like LOC100017176 __SEG__ Chr3 {Monodelphis domestica} MSYQDPGETEISTLTGFALETGEKAKGTGQITQLLLSLFTAVKDISYAVRKAGIVQLYGPTNVTVKEVKELDVFSNNLIINTLRSSFGTSVLVSEGSKHAIIIEPEKRGK
YVVCFDPLDGAANIHCLAPIGSIFGIYRRTSTGEPSQDDALQPGRNAVVAGYALYGSATMMVVAMDCGVNCFLLDSDIGEFILVHKNVQIRNRGNIYSINEGYTRDFEPA
VLEYLQEKKCPQDNTAPYNARYIGSMVADVHRTLVYGGIFLYPANEMCPQGKLRLLYECNPLAFIIERAGGLATTGKESVLDIVPTEIHQKIPLILGSPEDVKEFLKIYK
KYEKPVCQKCSFLKELPDDQRSHYME*
24 >lcl|XP_001371258.2|Plus1complement(15263096..15264199) NW_001581995 fructose-bisphosphate aldolase A-like LOC100017820 __SEG__ Chr7 {Monodelphis domestica} MTNPALTTEQKKELADIVHQMVCQGKGILVIDDSVCTMNKRLGCLGIDNNEENRRLFRQLFVTADDEIRNYVGGVILSHETFYQKCDDGRTFPEAIKAKNTAVGIKLDRG
VVPLAGTNNETTTQGLDGLSERCAQYKKDGADFAKWRCILKIGEHTPSSLAIMENANVLGRYASVCQQNGLVPLIEPDILTDGNHNLKQAQFITEKVLASVFKALSDHHI
FLEGSILQVNMVLPGHDCSQRYCPEDIAMATISALRNTVPPAVPAVAFLSGGQNEDDATVLLNAINKCSLPKSWILTFSYGRPLQSSPAKIWAGKDSHVKPAQQEYIRRA
KAVSQASEGKYCPPSSGRGMSHASEQLFISVYISNTV*
25 >lcl|XP_001372245.1|Plus1complement(905790..906983) NW_001581941 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8-like LOC100019371 __SEG__ Chr4 {Monodelphis domestica} MRCSKCLLCVLAGLTLLALKVYIEWSSDPLRPKRRGEGRGPETLSQPSALPPEPSLPANLSARLRQTGPLATAFWNRQQRQLQALPTGAGSAAGDCRTWGEAAAAEIPDF
SSYPEAHRRFLLSAACRDYPRWESGSAVPGCPDADAPYLLLAVKSSAGRFGERQAIRETWGAPEDGVRLLFLLGSPQGELGPDLGPLVEWESRRYRDLLLWDFLDVPFNR
SLLDVLLLRWLARHCPQVTFVLRAQDDSFVNLRALLGVLRGLPPATGRTLYLGHVFDQALPIRTPKGPYYVPETFYDGPYPAYASGGGYVFAGRLVPWLLQAARRVVPFP
IDDVYTGLCFQALGLAPQNHPGFLTNWPTRGKQDNPCAQQSLVLVQPRDPQETIRLWKLMQPPHAHC*
26 >lcl|XP_001372529.1|Plus1complement(26805964..26807166) NW_001581842 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9-like LOC100019798 __SEG__ Chr1 {Monodelphis domestica} MRLRRKADAALTLLLGTALCLLLYSQRESGTPAVGLASARDRMATVPAPPAFPTRPAWGPEVARAFPAAGAVLPVYEADTPEPPTPSGPFDFRRYLQAKDKRRFPLLINQ
PQKCRGLRGGPGPDLLIAVKSVAADFERREVVRKTWGAEGDVHRARVRRVFLLGMPRSAAGVGAQAQENLLRAEGRAYGDILLWAFDDTFFNLTLKEIHFLDWATAFCPD
ARFVFKGDDDVFVHVENLLEFVATRDPAQDLLAGDVILQARPIRARDSKYYIPEGVYGLGAYPAYAGGGGFVLSGATLRRLAAACAQVELFPIDDVFLGMCLQRLRLAPE
PHQAFRTFGIARPSAAPHLRTFDPCFYRELVLVHGLSAADIWLMWQMLHAVPGPDCARVRTAPKPFRWGS*
27 >lcl|XP_001373070.2|Plus1complement(37086791..37087993) NW_001581901 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7-like LOC100020646 __SEG__ Chr3 {Monodelphis domestica} MIPSKSLVYQRALMSLALFLSLTAVWRALDPVAEPPWSLRRGWAGDAFPGHYDFGLSPHEARVAQEKNLRMWDVQTSTCTANLSVMEKAWARHVQAHIRQFLIYRHCRYF
PILRNHPEKCAGKVYLLLAIKSGLPRHSQRETIRKTWGREREAGGGRGAIRTLFLLGTSPGREALDPDSQLLASEDSFHRDILQWDFLDSFFNLTLKEVNFLKWLDTFCP
RVSFIFKGDDDIFVSPANLLEFLQDRRPQENLLVGEVLDDARPIRAKRNKYYVPGALYSKTFYPPYAAGGGYLMTRRLAHGLFLASQTLELFPIDDVFQGMCLQVLRVRP
MHHKGFRSFGITGFRESHLNKDPCLFRSMLMVHNMQPKEMLSMWELVHRHLNCSHNFWISNTEALEEKKP*
28 >lcl|XP_001373509.1|Plus124240895..24242259 NW_001581859 alpha-galactosidase A-like LOC100021325 __SEG__ Chr1 {Monodelphis domestica} MFAFAALTLVLLGGPGITALDNGLALTPTMGWLPWERFTCNVNCIQDPENCISEQLFMQMADLMVSEGWKDAGYEYVCIDDCWLASKRNKDGTLKADPKRFPSGIRHLAN
YVHSRGLKLGIYQDVGTLTCAGYPGSFGYYDIDAQTFADWGVDLLKFDGCYYKDIESLVEGYKHMSIALNKTGRSILYSCEWPLYTRPFQEPNYTEIRQYCNHWRNYVDI
LDSWRSVKSILAWTASKQDSLVPAAGPGGWNDPDMLVIGNFGLSWDQQVTQMALWAIMAAPLFMSNDLRHISCRSKALLQNKDVIAINQDPLGKQGYLLRKDKNFEVWER
PLSNLAWAVAVLNQKEIGGPQNYAFSTSALGQGVGCAPACFITQILPVKEELGLYTWVSLLKVQVNPTGTVLLKLQAYQQHEYSSHTTRADFVSSNTTNDYHDYNYNNAT
SDDIISIITVLDPL*
29 >lcl|XP_001374025.2|Plus116914607..16915863 NW_001581861 beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3-like LOC100022052 __SEG__ Chr1 {Monodelphis domestica} MILATAVLKLSNNWECDFSDLGVESLDLWKKSCKDELYQSLKLSPINSINCSRITRGDPDALAQAALIKLEKKAERKPLTEAQYLNMTQDCAHFRVNRRFFQFPLSKEEK
DYPIAYSMVIHEKIENFERLLRALYAPQNIYCVHVDKKSPEAFKEAVGAITSCFPNVFVAKNLVQVVYASWSRVQADMNCMEELLNSSVPWRYLVNTCGTDFPIKTNAEI
VRSLKVLNGKNSMESEIPTTYKKFRWQYRYEVKDTIFRTRKIKPPPPHGLPMFTGNAYFVASRDFIQHLFKNPRAQKLIEWVKDTYSPDEHLWATLHRMPWMPGSVPYHE
KYHTSDLNAIARFVKWQGIDGDVRKGAPYPHCTGIYQRGVCVFGAGDLHFMLQSHHLLANKFDPKIDDSALQCLEEYLRHKAIYGREI*
30 >lcl|XP_001374027.1|Plus12510486..2511583 NW_001581914 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4-like LOC100022055 __SEG__ Chr3 {Monodelphis domestica} MSRRLGWLALYSLSVSLFTCLLFLKKTSKPALTSMASRQTGSPMARHPFWAPTGSHHNLCLPNSEVANASAVLPTRHRLFLTYKHCRNFSTLLQPTGCPADTFLLLAIKS
LPAHVDRRAAIRSTWGRIRGQGGGQKLKLVFLLGVGGTSPPPQLLAYESQEFDDILQWNFNEDFFNLTLKELHLQRWLTTSCPQAQFVLKGDDDVFVHVPNVLEFLRGQD
PSQDLFVGDVIREALPNRNIRVKYFIPPSMYRAHHYPPYAGGGGYVMSQATVRRLGVTVEEVDLFPIDDVFVGMCLKKLGVKPTHHAGFKTFGIRRPLDPLDPCLYKELL
LVHCLSPLEMWTTWALVKDEGLRCAAPPAQAQQTG*
31 >lcl|XP_001374334.1|Plus1complement(4821808..4822854) NW_001581841 alpha-(1,3)-fucosyltransferase-like LOC100022510 __SEG__ Chr1 {Monodelphis domestica} MSAYRLLFSHQAMVGMVLLIALWLLIAHFLSSSRPWDTGIWSLSGVLQPHSKLTVLIWHWPFNKSLPLDGDVCARYGVADCWLSTNRSLLHRANVVVFHHHELQSGAVRL
PLAKRPPGQPWVWTNLESPSNTHGLSRYRNIFTWVMSYRRDSDIFVPYGELVPRAGPDLPVPAKNRTAAWVISNYRRTQKRALVYSQLSKYLLIDVFGRASRKPLCAGCL
LPTLAPYRFYLAFENSQHPDYITEKLWRNALSAGVVPVVLGPPRATYEAFLPADSFVHVDDFGSVRDLATFLKSVNASHYQRFFAWRKRLAVRLYSDWRERFCGVCARYP
HLPQGQVYRDLEAWFKSQ*
32 >lcl|XP_001374982.1|Plus1complement(165604507..165605697) NW_001581841 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2-like LOC100031891 __SEG__ Chr1 {Monodelphis domestica} MSVGRRRIKLLGVLMMANFFIYLIVEVSKSTTQEDRGKEVIIPKSKFWQKHVPAKAYWNREQEKLNNLYNPILSILANTTVEENLISNASVLNSCEPDLSVISSVKDFEN
LPDRFKDFLLYLRCRNYSLLIDQLDKCKQKPFLLLAIKSLTSHFDRRQAIRESWGKETNFGNQTVVRVFLLGQTPPEDHFPDLSDMLKFESEKHQDILLWNYRDTFFNLT
LKEVLFLKWVSTSCPDVQFVFKGDDDVFVNTNQILNYLNSISKDKAKDLFIGDVIKDAGPHREKKLKYYIPESVYEGAYPPYAGGGGFLYSGSLALRLNKISEQVLLYPI
DDVYTGMCLQKLGLAPEKHRGFRTFDIEEKNRKNICSYTDLMLVHSRKPQEMISIWSQLQNLHVNC*
33 >lcl|XP_001376067.1|Plus1complement(33540457..33541863) NW_001581859 interferon-induced protein with tetratricopeptide repeats 1-like LOC100024986 __SEG__ Chr1 {Monodelphis domestica} MDENTMMDALTELRCHFTWDLLRVDNIDLTDLENRIQDEIECLDTNFRMSIHNTLAYVKLVRGQNEEALESLRKAEELIWEHYGDQAEIKSFVTWGNYAWIYYHMGEFPE
AQAYLEKVEAGCKKLLSPFRYKVELPEIDCEKGWALLKFGKEYYEEAKVSFEKALESEPDNPEFNTGFAICMFRLDLQEQYDKSISLEPLKKAVRINPEDAYLKVLLALK
LQACKQEEEGEKYLNEALNSMASKPYVLRYAAKFYCKKGYPDAGIDLLKNALRRTPTSNLLHSQMGFCYKAKVYQIKRATNFRPRGRDKQNLEKAIELSIFHFKTSIEYR
PTFELSYLELGDMYAETGDYNKAEESYQRVLNLKEIQDRTRQEVHYRFGRFNEFHRRSEVDALNHYLEALKIGKGKSLMGKGLPNSLEKFVKKRLRQNESDVETLSLLGF
IHKMKGETEKALEVYEAALGLDFSNSAF*
34 >lcl|XP_001376070.2|Plus1586148..587506 NW_001581944 beta-1,3-galactosyltransferase 6-like LOC100024991 __SEG__ Chr4 {Monodelphis domestica} MSSSRATGHPTPPLSPATSAPSEGDTPPRSFSRFYAPIPLTFASVTKIGEHRPRERGEGKSVTAPDEGNSERPIRARATATRAAPPPPSTDAPSSEQAVKVGREEVRTQP
RVRTGAMNLLRLVCRHRTALVLAGLALSATALLWLARCAPEGAGGGRAVAVAADAHAPVEAGELAERAFLAVLVVSAPAGTERRRAVRSTWLADAGQPGPLADVWARFVV
GTAGLAAPERRALEREQALHGDLLLLPVRDAYENLTAKVLAMFAWLDEHVAFDFVLKADDDTFARLGALRDELRARGPEQRRRLYWGFFSGRGRVQAGGRWREAAWLLCD
HYLPYALGGGYVLSADLVRFVSRSRDVLQHWRSEDVSLGAWLAPVDVHREHDPRFDTEYRSRGCSNQYLVTHKQSPDDMRAKQRSLAQHGHLCPQEVRLRLSYVYDWDVP
PSQCCRRREGIP*
35 >lcl|XP_001376361.1|Plus1541149..542036 NW_001581886 UDP-glucuronosyltransferase 1-7-like LOC100025419 __SEG__ Chr2 {Monodelphis domestica} MAPVLLGLLPLWSYLLLFGGLAEAGKLLVVPMDGSHWLSMREVVKELHRRGHEVVMVIPEVSWRLGESTPYTVKTYKPEYTLEEYNQVFQRFADSQWDDNFKTLVPMLTN
SNTSLFFKAIFSNGKSLFKNSELLDYIKKSAFDAILFDPFDHCGFFLAKYFSLPSLVFSRGIFCHYLEEATQCPSPLSYVPRGMSGLSDSMTFVDRVWNHFFHFQEVSLC
SFLFKTILDTASDIFQRPMTIKELYSHTSIWLLRTDFVFEYPKPLMPSIVFVGGITCHEVKPLSKVSLLLCEQDT*
36 >lcl|XP_001376379.2|Plus1555498..556433 NW_001581886 UDP-glucuronosyltransferase 1-10-like LOC100025445 __SEG__ Chr2 {Monodelphis domestica} MAPVLQPGGLLPLWSCLLLFGGLAEAGKLLVVPMDGSHWLSMREVVKELHRRGHEVVMVIPEVSWRLGESAPYTVKTYKSEHTLEEYNQVFQRFADGQWDGSFKTLVPLL
SNSNTTELFKAIYSNCRSLYKNSELLDYIKESAFDAVFFDPFDHCGFILAKYFSLPSVAFTRMVFCHHLDEATQCPSPLSYVPRGISGLPDSMTFMERVWNLFFHLQEVS
LCSHLLKYSLDIASDILQKPMTFKELYSYTSFWLLRTDFVFDYPKPLMPNMVLVGGITCHEGKPLSKVSLLLCGQDAWLGRSRSQEEFLDA*
37 >lcl|XP_001376420.2|Plus1632148..633038 NW_001581886 UDP-glucuronosyltransferase 1-10-like LOC100025503 __SEG__ Chr2 {Monodelphis domestica} MAPVLQPGGLLPLWSCLLLFGGLAEAGKLLVVPMDGSHWLSMREVVKELHRRGHEVVMVIPEVSWRLGESAPYTVKTYKPEYTLEEYNEMFQRFADHQWNNMRQTFSSLM
SNVNILEFFEKVCSNCRSLYKNSELLDYIKESAFDAVFFDPFDHCGFILAKYFSLPSVVFTRGLFCHYQDEATECPSPLSYVPRELSGCTSSMTFMQRVWNHFFHLQEVS
LCSFFLTRLLSFTSDIFQRSMTLKELYSQPSIWLLRTDFVFDFPKPLMPNMVFVGGITCYEEKALSKVSHLCGQDI*
38 >lcl|XP_001376446.1|Plus1650556..651470 NW_001581886 UDP-glucuronosyltransferase 1-6-like LOC100025544 __SEG__ Chr2 {Monodelphis domestica} MKAYSCLPLYWGVGSLFFLAFWDTAGSEKLLVLPIDGSHWLSMRDVTEELSKKGHEIVVLAPDVNLLLKESKFYKRKLFPVSYSQAELEKRFQTFGHRLFDERSFLGTAW
AEYCNNRHIIDLFFFNCDSLLKEQETIRYLEESKFDALLTDPALPCGVILAEHLAIPSVYFFRGFPCALEHAMSRTPNPVSYIPRCYTAFSHQMTFFQRVINFLVADLES
LLFKDLYTKYLKIASDFLKREVALPALYAKGSIWLLRYDFVFEYPRPIMPNMAFVGGINCKQRKKLRQVCDVGFLRCFPPRTPA*
39 >lcl|XP_001376466.1|Plus1663787..664656 NW_001581886 UDP-glucuronosyltransferase 1-3-like LOC100025583 __SEG__ Chr2 {Monodelphis domestica} MGLPCLPWALLRLAFCAACLGCAQGGKLLVIPVDGSHWLSMREVVQELSRRGHESIVLAPELTVHIREGPSYTLRTYPVTFSKDRFHELIHNSSQKIFQSEPLLKRIFDG
IATLKTLYEINLNFCTELVYNEELMKSLEEAKYDAVLTDPVIPCGAIVAQYLSIPAVYFLRGLPCGFDTESTQCPNPPSYVPRLATGNSDRMTFLERVKNVLYPSPQNAV
CLMLFSPFARLASELLQRDLSIVDVLSHGSVWLLRTDFLLEYPKPVMPNMVFIGGINCASNKQLPQVGG*
40 >lcl|XP_001376478.1|Plus1667527..668528 NW_001581886 UDP-glucuronosyltransferase 1-3-like LOC100025604 __SEG__ Chr2 {Monodelphis domestica} MARGLPHLPWLLVGLVAWAACLGCAQGGKLLVIPVDGSHWFSVREVVQELSRRGHESVVLAAELSMHIREGPLYTLRTFPVNFSNDQFEEVQGDPETLFEASNFLQRFFD
MAKIMKRYADMQSSFCTDLVSNKELMSALEQAHYDAVLTDPVNPCGAILALHLSLPAVYYFREIPCDFLAAGTHCPVPSSYVPRMFTENADRMTFPERVKNMLYALPHSV
ACHIMYSSFTKLATELLDRDVSIADILSHGSVWLLRSDFALDYPRPLMPNMVFIGGMSCASTKQLPQVGMWRVRGRRPASCEPSSNERRRLSLGSSMLFSGDNESAFSWV
SCQ*
41 >lcl|XP_001376972.1|Plus140515351..40516313 NW_001581837 probable UDP-sugar transporter protein SLC35A4-like LOC100026326 __SEG__ Chr1 {Monodelphis domestica} MNVEEGGIPGIGRPSQARWVLMLLLSTTMYGAHAPLLALCRIDGHVPFRPSSAVLWTELTKLLLSAFSLMARRQPRLWDTLPWRQAAPFALSALLYGANNNLVIHLQRYM
DPSTYQVMSNLKIGSTALLYCLCLNRRLSARQGLALLLLTGAGACYAAAGLQDPQGHLPPPPAASMPLHVTPLGLLLLLLYCLISGLSSVYTELLMKRQHLPLALQNLFL
YSFGVLMNLGLYVGGGPGPGLLEGFSAWAGLVVLSQALNGLLMSAIMKHGSSITRLFVVSSSLIVNAVLSATLLHLQLTAAFFLALLLIGLAVHLYYGGR*
42 >lcl|XP_001377109.1|Plus1complement(69884255..69885628) NW_001581879 phosphoglycerate kinase 1-like LOC100026536 __SEG__ Chr2 {Monodelphis domestica} MFYLSFEVACCRSGPARLSGSGSPGPPESPPRSRPSSPSKITLSRKLTLDKVDVKGKRVVMRVDFNVPMKNNEITNNQRIKAAIPSIKYCLDNDCKSVVLLSHLGRPDGI
PMPDKYSLVPVAVELQTLLGRNVDFLRDCVGPEVEKACADPVNGSIFLCENLRFHVEEEGKGIDESGNKITAEPAKVEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPQRACGFLMKKELEYFAKALENPVRPFLAILGGAKVADKIQLINNMIDKVCEMIIGGGMAFTFLKVVNKMQIGNSLFDEEGAKIVEDLMSKAEKKGVKLTLPVDFITAD
KFDEHASSGQATVESGIPDGWMGLDCGPESSKKFAEVVARAKLIVWNGPLGVFEWETFAQGTKQLMNNVVEATSKGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASL
ELLEGKVLPGVEALSNI*
43 >lcl|XP_001377518.2|Plus1complement(79062662..79063576) NW_001581902 n-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, isoform B-like LOC100027131 __SEG__ Chr3 {Monodelphis domestica} MFMETNLEMLKNSNSSVLDEVCDSIIKGQMISLQKTVLTTSFGKTSCQDYLLQSHYITTPLSKEEAQFPLAYVMVVHKDLETFERLFRAVYMPQNIYCIHVDEKATTEFK
DAVEWLVSCFSNVFLASKMETIVYAGISRLQADLNCIKDLVASKVQWKYIINTCGQDFPLKTNKEIIQHLKGFKRRNITPGVLPPPHITRRTNYVYREQKYGLLSFMLWT
LRKKTLPPHNLTIYFGSAYVALTREFANFVLQDQRAIDLLEWSKDTYSPDEHFWVTLNRIPGMADFHFYFGLLLGSMDIVKMKP*
44 >lcl|XP_001377583.2|Plus1complement(20145028..20146866) NW_001581841 phosphoglucomutase-2-like LOC100027227 __SEG__ Chr1 {Monodelphis domestica} MSVAAGDGPGGDSRLDQAATQWLRWDKNPKTLEMVKQIIANNNRVELQKCFGSRMEFGTAGLRAAMGPGFAQMNDLTIIQTTQGLCRYLEKTFSDLKKRGVVIGYDARAH
PSSGGGSKRFAQLAATAFISQGVPVYLFSNITPTPFVPYTVSHLNLCAGIMVTASHNPKQDNGYKVYWDNGAQIISPHDKGISQAIEENLEPWTKAWDDSIINNNPLHHD
PYSTINNDYFEDLKKYCFHRNIDQSTQLKFVHTSVHGVGHDFVQSAFKAFDFVPPDAVPEQKAPDPEFPTVKYPNPEEGKGVLTLSFALAEKTQAKIILANDPDADRLAV
AEQQENGEWKVFSGNEMGALLGWWLFTCWKEKNQDQNALKDLYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDG
VSAAVISAELASFLATKNMSLAQQLKAIYVEYGYHITKASYFICHDQNIIQNLFENLRNYDGKNNYPKTCGKFEVSGIRDLTTGYDSSQPDKKAILPTSKSSQMITFTFA
NGGVATLRTSGTEPKIKYYAELCVPPGNSDHEQLKKELDELVSAIEEYFFEPEKNKLQPKSE*
45 >lcl|XP_001378096.1|Plus181698716..81699702 NW_001581968 serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform-like LOC100027943 __SEG__ Chr5 {Monodelphis domestica} MAEEKFIKELNQWMKRLKDCHIFTEKQVHTLCEKAKEILMKESNVKEVSSPVTVCGDVHGQFQDVLEIFRIGGKLPDKKYLFMGDYVDRGFSSVETMTFLLSLKVQYPEF
ITLLRGNHECREITQVYGFYDECQKKYGNANVWKYFTDLFDYLPITALVDKQVFCLHGGLSPSIDTLDHIRGLNRFKEIPQTGPMCDLLWSDPADIKEWEPSPRGAGYIF
GADVSEIFSQANGLALISRGHQLVESGFSFSHNGRVLTIFSAPNYCYRFGNQAAIMELESPTKYSFIQFEQVPHVKCSVFSLLPDSYRQPWNKHWKNFGHYFQNLLRK*
46 >lcl|XP_001378867.2|Plus148052336..48054384 NW_001581978 uncharacterized family 31 glucosidase KIAA1161-like LOC100028979 __SEG__ Chr6 {Monodelphis domestica} MYTFIPDNFSPAKAKPPKELKPMLGSVLLGLLLVLAAVVAWCYYSISLRKAERLGAELLELRASGFSIRNQQGEQVFRLAFSSGALDLESCAREGAILSCSRSTGGPLNF
FIQTVRPKDTVMCYRVRWEELTPVPSVEHTMFLGDVHWYGGAEMRTQHWPIQLAGLQAPQPFVTSDVYSSRAAFGGILERYWLSSKAVAIKVNDSVPFHLGWNATGRSLL
LQARYHDTPYKPPAGRGPLPELSYRVCVGSDVTSIHKYMVRRYFNKPSKVPAREAFRDPIWSTWALYGRAVDQDKVLRFAEKIRKYRFNCSYLEIDDMYMPAYGDFTFDE
AKFPNATEMFRKLQEAGLRVTLWVHPFVNYNSSSFGEGVERGLFVREPTGRLPALVRWWNGIGAVLDFTHPAAREWFQGHLRRLRTQYSISSFKFDAGEVSYLPRDFSTF
RPLADPNLWSRRYTEMALPFFSLAEVRVGYQSQNISCFFRLIDRDSVWGHELGLRSLIPAVLTISMLGYPFILPDLIGGNAVPGHTAGMGVGDTGIPDRELYVRWLEVAA
FMPAMQFSIPPWLYDQEVVEIARKFAALRAELVAPLLLELAGEVTDTGDPIVRPLWWIAPGDEAAHRVDSQFLIGDTLLVAPVLEPGKQERDVYLPAGKWRSYKGELFVK
APILLTDYPVDLDEVAYFTWVS*
47 >lcl|XP_001379509.1|Plus161609994..61611235 NW_001581871 GPI mannosyltransferase 1-like LOC100029859 __SEG__ Chr2 {Monodelphis domestica} MKVRPLVGFWGGPAAVFGVALAARVALIFYGLYQDRTLVVKFTDIDYRVFTDGARLVMEGRSPYRRATYRYTPLLAWLLTPNISLSELFGKFLFVSCDLLTGFLMFRLLL
LTGLSPSRACGYSSWWLLNPLPLVVSSRGNAESLIAALVLTALYLLERRNVVWAALVYGLAVHMKVYPVTYLLPIALYLQTASGELEKDRSKSRVWGLARRLWNRDVLLF
GVVAGLTFFTLGLVFYYRYGWEFLEHTYLYHLTRRDIRHNFSPYFYMLYLTAESKWSFSLGLAAFLPQLLLLVVVSFAYYRDLAFCCFLHTAIFVSFNKVCTSQYFLWYL
CLLPLVMPQMRMSWKRAILLLGLWFMGQALWLAPAYFLEFQGKNTFLLIWLAGLLFLFINCYILIQIISHYQLGKLAKKIKSQ*
48 >lcl|XP_001380475.1|Plus15071925..5072704 NW_001581924 solute carrier family 35 member E4-like LOC100031148 __SEG__ Chr3 {Monodelphis domestica} MSSTHGAPAATLLLPWRRAPRAQGQGEGQWPAAGSPGRVLATVLVWLATGTGMSSLNKWLFAVHGFRYPLLLSALHMLTAVLLGYPLAGHRAHRPLPARAKRRLFLLSLT
FCAAVACGNLGLTYVHLDFAQMVYTTTPLFTLALSKAILGRRHHPLQYAAMGPICLGAACSILGEMHFHRTGCCFLFAATFLRGLKSVQQSEYPLPAVLGTLLPHKCQSS
LQLWDLRGLSLTGVPRPLLALAPPVLGSSSPGTPCSRLL*
49 >lcl|XP_001380823.2|Plus1complement(128183909..128185162) NW_001581879 phosphoglycerate kinase 1-like LOC100031601 __SEG__ Chr2 {Monodelphis domestica} MSLSNKLTLDKVDLKGKRVIMRVDFNVPMKNKEITNNQRIKAALPSISYCLDNGAKSVVLMSHLGRPEGIPMPEKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACTN
PPSGSIILLENLRFHVEEEGKGKDASGNKIKADPAKVEAFQASLSKLGDIYVNDAFGTAHRAHSSMVGVILPQKVSGFLMKKELTYFSKALESPERPFLAILGGAKVADK
IQLINNMLDKVNEMIIGGGMSYTFRKVLNNMEIGTSLFDEEGAMIVKDLMAKAEKNGVKITLPVDFVIADKYDENAKIGQATLASGIPAEWMGMDCGPESSKKYAEAVAR
AKQIVWNGPVGVFEWEPFARGTKELMNNVVEATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVAALSSV*
50 >lcl|XP_001381263.1|Plus1complement(68708047..68709636) NW_001581841 pyruvate kinase isozymes M1/M2-like LOC100032189 __SEG__ Chr1 {Monodelphis domestica} MEKTLSETDLPINPNQEYANKAENFLEYMCRLCIDSEPSVARNTAIICTIGPASQSVDTLKKMISAGMNVARINTCHGNQEEHAMMIKNVRTATDSFLSDPMFYRPIAIA
LDIKGPSVRTGLIKGSESAEVELKKGNSIKVTLDDTYKENCDENILWVDNKRVFTDIKIDGKIYVDNGLICLVVREKGNGFLLTEVTSGGMLGSKKCLNFPGLKMDFALT
TKDKEDLKFGLEQKVDMVFASFIQKAGDVQEVRKILGKEGESVLVISKIENHEGVKNFDEILKVSDGIMIARGDLGIEIPPQKVFLAQKMMIGRCNLAGKPVICATQMLQ
SMIKKPRPTRAESSDIANAVLDGVDCVMLSGETAKGDYPVECVKVQHRIAREAEAATFHLQLFNELVNLVPHNKDFTEITAVGAVKASFNYASEAIIVLTDTGKSAYLIA
RYHPRVPILAVIRDAQVARQVNLYRGIFPILYLKPVETKWTEDVEIRINYAMDVGKAQGFFKKDDMVIVVSGWCPEIGCTNTMNLLPVT*
51 >lcl|XP_003340432.1|Plus15821455..5822564 NW_001581878 beta-1,3-galactosyltransferase 4-like LOC100618101 __SEG__ Chr2 {Monodelphis domestica} MSFCLHPRCILLAAVTFLCIWAIFCPSEIRKELSCTPLMPAPAAPVPPLSLPHLLIPNIGVCTGLGSPLFLLILVSSAPDHQEQRDAIRASWGALQEIQGYLVRTLFMLG
EPSNSPLENIKEVLKQEAQVKGDIVQAAFMDSYRNLTLKTLSGLAWAAQYCPDVHYVLKTDDDVYINVPGLVAELKQRGNDLKKDWQQRYLDRDGTAARSPNLPVPYLYL
GHIHRRVYPSRSEYSRHWVSEVQWPSARGPFPPYGSGTGYVLSAPVLRLILRAAGGVPLIPVEDVFIGVIAKRVGVIPTHSIRIAGASRYPIDRCCFGRILLTSHHIEPW
EMKDIWELVKSSSGNRPLCSWLQEALGMLRCWVIHHWHF*