SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab G    

ID / Description / Sequence
1 >lcl|NP_001077063.1|Plus1complement(47802178..47803431) NW_001867389 phosphoglycerate kinase 2 PGK2 __SEG__ Chr20 {Equus caballus} MSLSKKLTLDKLDVKGKRIIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGARSVVLMSHLGRPDGVPMPDKYSLEPVAAELKSLLGKDVLFLKDCVGSEVEKACAN
PATGSVILLENLRFHVEEEGKGQDPSGNKLKAEAGKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGINLPQKASGFLMKKELEYFAKALENPERPFLAILGGAKVADK
IQLIKNMLDKVNEMIIGGGMAYTFLKVLNNMEIGASLFDEEGAKIVKDIMAKANKNGVRITFPVDFVTADKFEENAKVGQATVASGIPAGWMGLDCGPETNKKYAQVMAQ
AKLIVWNGPVGVFEWDAFAKGTKALMDEIVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVDALSNL*
2 >lcl|NP_001099004.1|Plus1complement(14980058..14981344) NW_001867394 beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase GCNT1 __SEG__ Chr23 {Equus caballus} MLRKLLRRRLFSYPTKYYFLLLVFSVVTFSVLRIHQKPEFVSVGHLELVGENPSSDINCTKVLQGDVDEIQKVKLEILTVKFRKRPRWTAYDYINMTNDCTSFIKRRKYI
VEPLSKEEAEFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKSEDSFLAAVIGIASCFSNVFVASQLESVVYASWSRVQADLNCMQDLYRMSADWKYLINLCGMD
FPIKTNLEIVRKLKSLMGENNLETERMPSNKKERWKKHYAVVNGKLTNTGTDKVHPPLETPLFSGSAYFVVSREYVEYVLENEKIQKFMEWAKDTYSPDEYLWATLQRIP
EVPGSLSLSHKYDMSDMHAIARFVKWQYFEGDISKGAPYPPCSGVHVRSVCVFGAGDLNWMLRMHHLFANKFDTDIDLFAIQCLDEHLRHKALETLKH*
3 >lcl|XP_001488705.1|Plus1779088..780089 NW_001867433 glyceraldehyde-3-phosphate dehydrogenase-like LOC100050395 __SEG__ Chr9 {Equus caballus} MVKVGVNGFGRIRRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDFTHGKFHGTVKAEHGKLVINGKAITIFQERDPANIKWGDAGAEYVVESTGVFTALEKAGAHL
KGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTSCLAPLAKVIHDHFGIVEGLMTAVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIP
ELNGKLTGMASRVPTPNVSVVDLTCRLEKAAKYDEIKKVVKQASEGPLKGILGYTEDQVVSCDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNKVVDLMAHMA
SKE*
4 >lcl|XP_001492581.1|Plus120566045..20567706 NW_001867411 glycerol kinase 2 GK2 __SEG__ Chr3 {Equus caballus} MAAPKKAVVGPLVGAVVQGTNSSRFLVFNSKTAELLCRHQVELTQEFPKEGWVEQDPKEILQSVYECIEKTCEKLGELNINISNIKAIGVSNQRETTVIWDKVTGEPLYN
AVVWLDLRTQSTVENLSKKIPGNNNFVKSKTGLPLSTYFSAVKLRWILDNVRKVQKAVEEGRALFGTVDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKELC
DFFEIPKDILPKVWSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQEGQAKNTYGTGCFLLCNTGRKCVFSEHGLLTTVAYKLGRDKPVCYALEGSVAIAGAVVR
WLRDNLGIIETAEEIEKLAKEVGTSYGCYFIPAFSGLYAPYWDPSARGLICGLTQFTNKRHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGLTNNKVLMQLQAD
ILHIPVIKSCMSETTALGAAMAAGAAEGVGVWSLEPEDLSTITIERFEPRIQATESNTRYSTWKKAVMKSMGWATTQSPENGDANIFSSLPLGFFVVSSMIMLIGARYIS
GVP*
5 >lcl|XP_001493861.3|Plus135579857..35580792 NW_001867397 beta-1,3-galactosyltransferase 5-like LOC100051491 __SEG__ Chr26 {Equus caballus} MANVKMMLLCLSLVVLGALCLYLSMYTLIPFKEGPFVFKRRQENFLQLPDVDCGQNPPFLVLLVTSSQEQTLARTVIRNTWGQEKIVKGKRIKTLFLLGTTTSKATSKAV
AHEGRQYRDIIQKDFLDVYFNLTLKTMMGIEWIHRFCPQAAFVMKTDSDMFINIYYLTELLLKKNRTTRFFTGFLKMHDYPIRMKQSKWFVSKYEYPWDRYPPFCSGTAY
VFSGDVARQVYEVSETVPFLKLEDVFVGLCLAKLKIKPEELHSEQTFFPGGLSFSTCRFRKIVASHFVKPNDMLIYWHALESSLGEECPAV*
6 >lcl|XP_001494566.2|Plus110462519..10463499 NW_001867389 n-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, isoform A-like LOC100063202 __SEG__ Chr20 {Equus caballus} MVSWKHCLFSVSLITVLVLVFVYNNELWESKQFLRASLSNASLLAEVCHQIFNGKVFYPTENALKTTLSDSTCYDYVAQSHYITETLSEEEAGFPLAYAVTIHKDFGTFE
RLFRAIYMPQNVYCVHVDEKATDTFKDAVQQLLSCFPNAFLASKMEPVVYGGISRLQADLNCIKDLAASEVPWKYAINTCGQDFPLKTNKEIVQYLKGFKGKNITPGVLP
PAHAIGRTKYVHRELLSKKYSYVHKTTNLKTLPPHNMTIYFGTAYVALTREFANFVLQHQLALDLLSWSKDTYSPDEHFWVTLNRIPGMYVSTSVFMNKHCMVSTE*
7 >lcl|XP_001495367.1|Plus1complement(35772623..35773816) NW_001867379 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2-like LOC100064405 __SEG__ Chr15 {Equus caballus} MTVGRRRIKLLGILMMLNVFIYLIVEVSKSSNQEKNGKGEVIIPKGKFWKISEPPVAYWNREQEKLNRRYNPILNMLTNQTGEVYGFSNVSHLNYCEPDLRVASVVSGFD
NLPDRFKDFLLYLRCRNYSLLIDQPNKCAKKPFLLLAIKSLTSHFARRQAIRESWGRETNVGNRTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNL
SLKEVLFLRWVSTSCPNAEFVFKGDDDVFVNTHHILNYLNSLSKNKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYTGVYPPYAGGGGFLYSGHLALRLHSITDQVLLYP
IDDVYTGMCLQKLGLLPEKHKGFRTFDIEEKNKNNICSYLDLMLVHSRKPQEMIDIWSRLQNAHLNC*
8 >lcl|XP_001495913.2|Plus113008711..13009730 NW_001867422 UDP-glucuronosyltransferase 1-6-like LOC100065196 __SEG__ Chr6 {Equus caballus} MACLLRAFGRVSAGVFFLSLWGMSVGDKLLVFATDGSHWLSMKDIIEPLSEKGHDIVVLVPEVSLLVKESKYYTRRIYPVPYDEEELKRCVRSFGKNHFAERWLLNAAQA
AYRNIMMLMDVAFLNCQSLLNHSETLSFLRESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLQYAFTRSPNPVSYVPRCFTQFSDQMTFPQRVANFLVSYLEPF
LFCCVLSKYEDPTWNLLKRDVHLPALYQKGSIWLLRYDFVFEYPKPVLPNMVFIGGVNCKKEGILSQVGVLFLFDCPYSLWVDILLPHSVLSVVWLRGLTVTWGGCVKNS
IGKGMPGWE*
9 >lcl|XP_001496338.1|Plus1complement(17620052..>17621212) NW_001867410 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9-like LOC100065795 __SEG__ Chr3 {Equus caballus} LGAVLGLVLYAHRDGAAPTTSLPRAQGRAAPGPASGPTLGLRVFQAPDAGAAPPAYEGDTPEPPTPTGPFDFGRYLRAKDQRRFPLLINQPYKCRGDGGPDLLVAVKSVA
ADFERRQAVRQTWGAEGRVQGKLVRRVFLLGVPRGGGTDGADAEGEGARTHWRALLRAESRAYTDILLWAFDDTFFNLTLKEIHFLAWASTYCPDVRFVFKGDADVFVHM
GNLLEFLAPRDPTQDMLAGDVIVQARPIRVRASKYYIPEAVYGLPAYPAYAGGGGFVLSGATLHRLAGACTEVELFPIDDVFLGMCLQRLRLTPEPHPAFRTFGIPRPSA
APHLRTFDPCFYRELVVVHGLSAADIWLMWRLLYGPQGPACARPRPVAAGPFQWGP*
10 >lcl|XP_001496364.2|Plus121689169..21690308 NW_001867385 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5-like LOC100058694 __SEG__ Chr19 {Equus caballus} MVVRMFYRRRVKKRKLVHLFATCSILTLMFYWGTTDNLVISYMKSYSYRYLINSYDFVNDSLSLKRRVDGATRYQYLINHVEKCQAQDVLLLLFIKTAPENSDRRSAIRK
TWGNEEYVWSQLNANIKTLFALGTPSNPQDRELQRELVLEDQKYNDIIQQDFVDSFHNLTLKFLLQLSWANSFCPHAKFLMTADDDIFIHMPNLIEYLQSLEQIGVQDFW
IGRVHLGAPPVRDKSSKYYVSYEMYQWPAYPDYTAGAAYVISNDVAAKVYEASQTINSSLYIDDVFMGLCANKRGIVPQYHVFFSGEGKTPYHPCIYEKMMTSHGHVQDL
EDLWKDATDPKVKTISKGFYGQIYCRIIKIILLCKLTYVDTYPCRAAFI*
11 >lcl|XP_001497149.1|Plus133707366..33708520 NW_001867389 beta-1,3-galactosyltransferase 4-like LOC100052704 __SEG__ Chr20 {Equus caballus} MPLSLFRRFLLAVLLLVIVWTLFGPSGIGEELLSLSLASLLPAPASPGPPLALPRLLIPNEEACGGPGAPPFLLILVCTAPENLNQRNAIRASWGGLREARGLRVQTLFL
LGESSWRHLTGVSHENDLARESAAQGDIVQAAFQDSYRNLTLKTLSGLNWADKHCPMARYILKTDDDVFVNVPELVSELVRRGGRWEQWEKGMEPQRDPEVGHEEQEGGG
PTLGSQPVPLLYLGRVHWWVHPSRTPGAKHWISEEQWPPTWGPFPPYASGTGYVLSASAVQLVLKVASRAPLLPLEDVFVGVSARRGGLTPTHCVKLAGATHYPLDRCCY
GRFLLTSHRLDPWKMQEAWKLVGGSDGERTAPFCSWLEGVLGLLRCRVIAWLHS*
12 >lcl|XP_001497162.1|Plus147662410..47663390 NW_001867384 beta-1,3-galactosyltransferase 1 B3GALT1 __SEG__ Chr18 {Equus caballus} MASKVSCLYVLTVVCWASALWYLSVTRPTSSYTGTKPFSHLTVARKNFTFGNIRTRPINPHSFEFLINEPNKCEKNVPFLVILISTTHKEFDARQAIRETWGDENNFKGI
KIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVINGGPIRDVRSKW
YMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVITVHQISPEEMHRIWNDMSSKKHLRC*
13 >lcl|XP_001498412.2|Plus1<22271365..22273242 NW_001867404 transketolase-like 2 TKTL2 __SEG__ Chr2 {Equus caballus} IADNAKPRANTLQVLRDMANRLRIHSIRATCASRSGHPTSCCSAAEIMSVLFFHTMRYKQTEPEHPDNDRFILSKGHAAPILYAAWAELGIISESDLLNLRKINCDLEGH
PTPRLSFVDVATGSLGQGLGAACGMAYTGKYFDKASYRVFCLMGDGESSEGSVWEALDFASHYNLDNLVAVFDVNRLGQSGVTPLEHCTDVYQNRCEAFGWNTYLVDGHD
VEGLCHAFWQATQVKNKPTAIVAKTFKGRGIPDIEDAENWHGKPMPKERADAIIKLIESQIQTNRNFIVKPPLEDSPQVSIRNIKMTCLPDYEVGDKIATQKAYGLALVK
LGRANDRLIVLDGDAKNSTFSEIFKKEYPERFIECVMAEQNMVSVALGCATRDRTVAFISTLAACLTRAFDQIRMGAISQTNINLIGSHCGVSMGEEGSSQMALEDLAMF
RSIPNCTVFYPSDAISAEHAVYLAASTKGMCFIRTSRQETAVIYTPQENFVIGQARVIRHSVNDKVTVIGAGVTLHEALAAAADLSQQGISIRVIDPFTIKPLDAATIIS
SAKATGGRVITVEDHYREGGLGEAVCTAVSGEPDILVHQLAVSGVPQSGKPGELLDMFGISARHIIAAVKYTLMN*
14 >lcl|XP_001498447.1|Plus1complement(50338512..50340656) NW_001867394 uncharacterized family 31 glucosidase KIAA1161-like LOC100068574 __SEG__ Chr23 {Equus caballus} MPQKPDEKSQAYPRRRPGSHTGRKSPEAVAAAAMYTFVPDNFSPSKPKPSKELKPLLGSAVLGLLLVLAAVVAWCYYSASLRKAERLRTELLDLNRGGFSIRNQKGEQVF
RLAFRSGALDLDSCSRDGALLGCSRTADGRPLHFFIQTVRPKDTVMCYRVRWEEAVPGRAVEHAMFLGDAAAHWYGGAEMRTQHWPIRLDGQQEPQPFVTSDVFSSNAAF
GGILERYWLSSRAAAIKVNDSVPFHLGWNSTERSLRLQARYHDTPYKPPAGHAAAPELSYRVCVGSDVTSIHKYMVRRYFNKPSRVPAPEAFRDPIWSTWVLYGRAVNQD
KVLRLAQQIRQHRFNSSHLAIDDMYTPAYGDFDFDEAKFPNASDMFRRLRDAGFRVTLWVHPFVNYNSSCFGEGVERELFVREPTGRLPALVRWWNGIGAVLDFTRPEAR
DWFQGHLRRLRSRYAVASFKFDAGEVSYLPRDFSTYRPLPDPSVWSRRYTEMALPFFSLAEVRVGYQSQNISCFFRLVDRDSVWGYDLGLRSLIPAVLTVSMLGYPFILP
DMVGGNAVLERTAGGGGVPERELYVRWLEVAAFMPAMQFSVPPWQYDAEVVAIAHKFAALRASLVAPLLLELAGEVTDTGDPIVRPLWWIAPGDETAHRIDSQFLIGDTL
LVAPVLEPGKQERDVYLPAGKWRSYKGELFDKTPVLLTDYPVDLDEVAYFIWAS*
15 >lcl|XP_001500400.1|Plus1complement(11956316..11957509) NW_001867363 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8-like LOC100065028 __SEG__ Chr10 {Equus caballus} MRCPKCLLCLSALLTLLGLKVYIEWTSESQLSKAYPGPRDTPQGPTPASPEPTLPANLSARLGQTGPLPSAYWNQQQWRLGALPSGDSAEAGDCRAWGAAAAAEIPDFTS
YPEDLRRFLLSAACRSFPQWLPGGGSGQVASCTDTDAPYLLLAVKSEPGHFAERQAVRETWGGPAPGIRLLFLLGSPVGDGGPDLGSLVAWESHRYSDLLLWDFLDVPFN
QTLKDLLLLAWLDHHCPGVSFVLQAQDDAFVHTPALLDHLRALPPTWARGLYLGEVFTQAKPLRKPGGPFYVPGSFFEGGYPAYASGGGYVIAGRLAPWLLQAAARVAPF
PFDDVYTGLCFQALGLVPRAHKGFLTAWPADRTADPCTLRDLLLVRPLSPQDSIRLWKHLRDPQLQC*
16 >lcl|XP_001501152.1|Plus1complement(4446664..4447620) NW_001877047 c1GALT1-specific chaperone 1-like LOC100055183 __SEG__ ChrX {Equus caballus} MLSESSSFLKGVMLGSIFCALITILGHVRIGYGSRMYHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFKS
INMETNDMWLMMRKAYKYAFDNYRNQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTVKSGDLEYVSVEGGIVLSIESMKRLNHLLSIPEKCPEQGGMIWKISED
KQLAVCLKYAGVLAENAEDSEGKDVFNTKSVGLFIKEAMTNHPNLVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHVFNDALVFLPPNVSDND*
17 >lcl|XP_001502410.1|Plus170952233..70953234 NW_001867384 glyceraldehyde-3-phosphate dehydrogenase-like LOC100054877 __SEG__ Chr18 {Equus caballus} MVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYVVYMFQYDSTHGKFHGTVKAKHGKLVINGKVITIFQERDPANIKWGDAAAEYVVESTGVFTTLEKAGAHL
KGGAKRVIISAPSADAPMFVTGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDHFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIP
ELNGKLTGMAFRVPTPNVSVMDLTCCLEKAAKYDEIKKVVKQASEGPLKGILGYTEDQVVSCNFNSDTHSSTFNAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMA
SKE*
18 >lcl|XP_001503875.1|Plus119589063..19590142 NW_001867364 alpha-(1,3)-fucosyltransferase-like LOC100071396 __SEG__ Chr10 {Equus caballus} MTPASKGILRPFLIVCIILGCFVACLFIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILIWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHH
RDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQ
AFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNDKLYLSYFNWRKDFTVNLPRFW
ESHACLACDHVKRHQEYKSVGNLEKWFWN*
19 >lcl|XP_001504214.1|Plus1complement(36301489..36302463) NW_001867377 probable UDP-sugar transporter protein SLC35A4-like LOC100061903 __SEG__ Chr14 {Equus caballus} MSVEDGGMPGLGRPRQARWTLMLLLSTAMYGAHAPLLALCRVDGQVPFRPSSAVLLTELTKLLLCTFPFLVGWQAWPRGAPPWRQAVPFALSALLYGANNNLVIYLQRYM
DPSTYQVLSNLKIGSTALFYCLCLRHRLSARQGLALLLLMAAGVCYAAGGLQNPGNLPSGPPPAAAASPMPLHITPLGLLLLVVYCLISGLSSVYTELLMKRQRLPLALQ
NLFLYTFGVLLNLGLHAGGGPGPGLLEGFSGWAALVVLSQALNGLLMSAVMKHGSSITRLFVVSCSLVVNAMLSAALLRLQLTAAFFLATLLIGLAVRLYYGSR*
20 >lcl|XP_001915859.1|Plus1complement(12287914..12289182) NW_001867407 beta-1,3-galactosyltransferase 2 B3GALT2 __SEG__ Chr30 {Equus caballus} MLQWRRRHCCFAKMSWNAKRSLFRTHLIGVLSLVFLFAMFLFFNHHDWLPGRAGFKENPVTYTFRGFRSTKSETNHSSLRNLWKETVPQTLRPQTAINSNNTDLSPQGVT
GLENTLSANGSIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAEPGQIEARRAIRQTWGNESLAPGIQVTRIFLLGVSIKLNGYLQRAILEESRQYHDIIQQEY
LDTYYNLTIKTLMGMNWVATYCPHIPYVMKTDSDMFVNTEYLIHKLLKPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMPPELYPSERYPVFCSGTGYVFSGDLAEKIFKV
SLSIRRLHLEDVYVGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRKLH*
21 >lcl|XP_001917534.1|Plus1complement(38570195..38571298) NW_001867396 alpha-(1,3)-fucosyltransferase-like LOC100067846 __SEG__ Chr25 {Equus caballus} MAVSVWSLGNPELGGWGLWLSPRRQPLFAWHGPTQRLRALVSLAGVALLMALWLLWLLQSSPGGAPMPQPTLTILIWHWPFTYPPPELPSNTCTSYGVARCHLSTNRSLL
ATADAVVFHHRELRDGRIRLPLAERPRGQPWVWASMESPSNSHGLSDFRGIFNWVLSYRRDSDIFVPYGRLEPREGPAPPLPPKDRVAAWVVSNFRERQRRVQLYRQLAP
HLQVDVFGRANRRPLCASCLLPTVSRYRFYLSFENSQHRDYITEKLWRNALAAGAVPVVLGPPRATYEAFVPPDAFVHVDDFGSARELAAFLTGMNESSYRRYFAWRDRL
RVRLVEDWRERFCAICARYPHLPRSQVYQDLQGWFQS*
22 >lcl|XP_003365195.1|Plus113058907..13059908 NW_001867422 UDP-glucuronosyltransferase 1-3-like LOC100630747 __SEG__ Chr6 {Equus caballus} MAVGLRVPLLALAGLLLFLCVGPWAEGGKVLVVPMEGSHWLSMREVVRELHARGHQVVVLSPEVTLHVKKEDFFTMKTYSVSYTQDEFDHLLLGQSHTAFERAHFLKRLW
TSMTNLQKASLIFQKFCEELVYNKDLISHLNASSFDVVLTDPVYPCGAVLAAYLKLPAVFFLRHIPCDLDFESAQCPNPSSYVPKLLTMNSDHMTFLQRVKNMLYPLSLK
YICHVTLVSYASLASKLLQREMSLVDVLGSASVWLFRGDFVLDYPRPIMPNMVFIGGINCAHRKPLSQVSIGALIQSMFQAEHIFFVTYSQVLTYPPIFLEISTSHSPSN
NLP*