SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam G    

ID / Description / Sequence
1 >lcl|NP_001005378.1|Plus128985874..28986926 NW_876272 fucosyltransferase 5 FUT5 __SEG__ Chr20 {Canis lupus familiaris} MRWSQEEPVWFSMSRTNTAESPAMAPNGSAGPVTSQGAPCQATRGSSACRPLLLLLWTWPFHHPVALSPCSDMWPGTTDCRLTANRSVYPEADAVLVHHREVSYRPKEQL
PTSPRPPGQRWVWFSMESPSHCAQLKALDGYFNLTMSYRRDSDIFTPYGWLEPWPGQPAAPLVNLSAKTELVAWVVSNWREDSVRVRYYHKLQAHVQVDVYGQRHKPLPQ
RNMIQTLSQYKFYLAFENSLHRDYITEKLWRNALDAWAVPVVLGPSRKSYEQFLPADAFIHVDDFQNPKDLAQYLLSLDKDDARYLAYFRWRETLRPRTFSWSLMFCKAC
WRLQQESAYQTVPSIASWFT*
2 >lcl|NP_001005379.1|Plus1839573..840640 NW_876333 alpha-(1,3)-fucosyltransferase FUT7 __SEG__ Chr9 {Canis lupus familiaris} MGPWGKPGKTASPVSHVGYSLSRRLRAVGVLAGAALLSAIWLLWLLGSPPTGGPAPPHTLIILIWHWPFSDRPPELPSNTCISFGVAHCHLSTNHSLLASADAVVFHHRE
LQTQQARLPLAKRPRGQPWVWVSMESPSHTHGLGRLGGIFNWVLSYRRDSDIFVPYGQLEPHQGPAPPLPAKKRVAAWVVSNFQERQRRVQVYRQLAPHLQVDVFGRANR
QPLCANCLLPTVAQYLFYLSFENSQHQDYITEKFWRNALAAGTVPVVLGPPRATYEAFAPADAFVHVDDFSTAQELASFLANMNESHYRRYFAWRDRLRVRLFGDWRERF
CAICTHYPHLPRGQVYQDLQGWFQA*
3 >lcl|NP_001005380.1|Plus154774098..54775177 NW_876254 alpha-(1,3)-fucosyltransferase FUT9 __SEG__ Chr12 {Canis lupus familiaris} MTSASKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILIWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHH
RDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQ
AFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFW
ESHACLACDHVKRHQEYKSVGNLEKWFWN*
4 >lcl|NP_001074191.1|Plus12722940..2724091 NW_876254 beta-1,3-galactosyltransferase 4 B3GALT4 __SEG__ Chr12 {Canis lupus familiaris} MPLSLFRRLLLAALLLVIIWTLFGPSGIGEELLSLSLASLSPAPASPGPPLALPRLLIPNEKACGGPGSPPFLLILVCTAPENLNQRNAIRASWGGLREAQGFRVQILFL
LGEPSLWHPTKEPHDIDLVREAAAQGDILQAAFRDSYRNLTLKTLSGLNWADKHCSMARYILKTDDDVFVNVPELVSELIRRGGHWEQWEKGKEPPRAVKAGDKEWEERP
ILKSQPMPLLYLGRVHWRVHPSRTPGSKHQISEEQWPPTWGPFPPYASGTGYVLSASAVQLILKVASRAPPLPLEDVFVGVSARRGGLTPTHCVKLAGATHYPLDRCCYG
KFLLTSHKLDPWKMQEAWKLVGGSDGERTAPFCSWLQEVLGILRCRVIAWLHS*
5 >lcl|XP_003432515.1|Plus122385916..22386524 NW_876267 heparan-sulfate 6-O-sulfotransferase 1-like LOC100688113 __SEG__ Chr19 {Canis lupus familiaris} MCDGRTPTPEELPPCYEGTDWSGCTLQEFMDCPYNLANNRQVRMLADLSLVGCYNLSFIPEGKRAQLLLESAKKNLRGMAFFGLTEFQRKTQYLFERTFNLKFIRPFMQY
NSTRAGGVEVDEDTIRRIEELNDLDMQLYDYAKDLFQQRYQYKRQLERREQRLKSREERLLHRAKEALPREDADEPGRVPTEDYMSHIIEKW*
6 >lcl|XP_003432843.1|Plus128969826..28970977 NW_876272 galactoside 3(4)-L-fucosyltransferase-like LOC100683739 __SEG__ Chr20 {Canis lupus familiaris} MDPHILAKIRCPWRHYLFGVLFQLLLALCFFSYMRWSQEEPVWFSMSRTNTAESPATAPNGSAGPVTSQGAPCQATRGSSACRPLLLLLWTWPFHHPVALSPCSDMWPGT
TDCRMTANRSVYPEADAVLVHHREVSYRPKEQLPTSPRPPGQRWVWFSMESPSHCAQLKALDGYFNLTMSYRRDSDIFTPYGWLEPWPGQPAAPLVNLSAKTELVAWVVS
NWREDSVRVRYYHKLQAHVQVDVYGQRHKPLPQRNMIQTLSQYKFYLAFENSLHRDYITEKLWRNALDAWAVPVVLGPSRKSYEQFLPADAFIHVDDFQNPKDLAQYLLS
LDKDDARYLAYFRWRETLRPRTFSWSLMFCKACWRLQQESAYQTVPSIASWFT*
7 >lcl|XP_003432971.1|Plus133550181..33551182 NW_876273 glyceraldehyde-3-phosphate dehydrogenase-like LOC100687814 __SEG__ Chr21 {Canis lupus familiaris} MVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSIHGKSHGTVKAENGKLVINGKSISIFQEQDPANIKWGDAGAEYVVESTGVFTIMKKAGAHL
KGGAEREGVSAPSADAPMFVIGVNHEKYDNSLKIVSNASGTTNCLAPLAKVIHDHFGIVEGLMTTVHAITATQKTVDGSSGKLWHDGRGAAQNIIPASTGAAKAVGKVIP
ELNGKLTGMAFHVPTPNVSVVDLTCRLEKAAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSDSHSSTFDARAGIALNDHFVKLISWYDNEFGYSNQVVDLMVHMA
SKE*
8 >lcl|XP_003432991.1|Plus1complement(6388269..>6389351) NW_876273 alpha-(1,3)-fucosyltransferase-like LOC100682680 __SEG__ Chr21 {Canis lupus familiaris} GGGRRGRGCGAPALAAAGLLCTALAAYSCWGQLPPPPWAPPAPPRPVGVLLWWEPFAGRAGGARRPPDCWLRFRIRGCRLLADRAAYGEAQAVLFHHRDLVRGAPDWPPP
WGGHPRPPGQRWVWMNFESPSHSPGLRHLAGDLFNWTLSYRADSDVFVPYGRLYPRAHPGDPPPGPAPPLARKRGLVAWVVSNWDERQARVRYYRQLSRHVPVDVFGRAG
PGRPVPDSGLLHTVARYKFYLAFENSQHPDYITEKLWRNALLAGAVPVVLGPDRANYERFLPRGAFIHVDDFPSASSLAAHLLFLDRNPAVYRRYFHWRRSYAVHITSFW
DEPWCRACQAVQAAGDRPQSVRNLARWFER*
9 >lcl|XP_003433376.1|Plus126468203..26469081 NW_876279 UDP-glucuronosyltransferase 1-8-like LOC100688543 __SEG__ Chr25 {Canis lupus familiaris} MAATILTGFPLLCVCLLLTSGFAEAGKLLVVPMDGSHWFTMRLVVEQLIQRGHELVLIIPEVSWQLGKSSNFTVKTYSTTYNLEELNQMFKNFSDSHWNIRQQSLLTMFF
DSSSDIFEHLFLHCKNLFSDPKLVEYIKESSFDAVFLDPFDVCGLIVAKYFSLPSVGFTRRLYCHYLEEATQCPSSPSYVPRPFSILSDVMSFRERVRNHIFHLEEHLFC
HYFLKTALEVASEILQKAVTPYDLYSHMSIWLLRTDFVFDYPKPVMPNMVFIGGINCQEGKPLPKVSYLFFA*
10 >lcl|XP_003433377.1|Plus126498150..26499028 NW_876279 UDP-glucuronosyltransferase 1-8-like LOC100688694 __SEG__ Chr25 {Canis lupus familiaris} MAATILTGFPLLCVCLLLTSGFAEAGKLLVVPMDGSHWFTMRLVVEQLIQRGHELVLIIPEVSWQLGKSSNFTVKTYSTTYNLEELNQMFKNFSYSQWKTQQQSSLFLVL
SPLKDSLEHLFLHCKNLFSDPKLVEYIKESSFDAVFLDPFDVCGLIVAKYFSLPSVGFTRRLYCHYLEEATQCPSSPSYVPRPFSILSDVMSFRERVRNHIFHLEEHLFC
HYFLKTALEVASEILQKAVTPYDLYSHMSIWLLRTDFVFDYPKPVMPNMVFIGGINCQEGKPLPKVSYLFFA*
11 >lcl|XP_003433378.1|Plus126507842..26508759 NW_876279 UDP-glucuronosyltransferase 1-10-like LOC100688763 __SEG__ Chr25 {Canis lupus familiaris} MAATILTGFPLLCVCLLLTSGFAEAGKLLVVPMDGSHWFTMRLVVEQLIQRGHELVLIIPEVSWQLGKSSNFTVKTYSTTYNLEELNQMFKNFSYSQWKTQQQSSLFLVL
SPLKDSLEHLFLHCKNLFSDPKLVEYIKESSFDAVFLDPFDVCGLIVAKYFSLPSVVFTRGLFCHFFEESTQCPSPLSYVPRPFSMLSDAMSFRERVRNHIFHLEEHLFC
HYFLKTPLEVASEILQTAVTPYDLYSHTSIWLLRADFVLDYPKPVMPNMVFIGGINCQEGKTLPKVSYLFFCVVRIIWLWTLEKK*
12 >lcl|XP_003433967.1|Plus124477308..24478621 NW_876294 beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 GCNT3 __SEG__ Chr30 {Canis lupus familiaris} MIWWKKRCRQHYLWALGCYVLLAVVALRFSLRLKCDFDSLDLESRDFRSQHCRDILYQSLKLPAKRSINCSRIIRGDWQAVSEALLDNLEVKKKRKPLTDTDYLNMTRDC
EHFKAKRKFIRFPLSKEELDFPIAYSMVVHEKIENFERLLRALYAPQNIYCVHVDEKSPETFKEAVKAIISCFPNVFIASKLVRVVYASWSRVQADLNCMEDLLRSSVPW
KYLLNTCGTDFPIKTNAEIVLALKMLNGKNSMESEKPTEYKKSRWKYHYEVTDTLYITSKMKDPPPENIPIFTGNAYIVASRDFVRHVLENPKSRRLIEWVKDTYSPDEH
LWATLQRAPWMPGSIPYHPKFHISDMIAIARLVKWQSHEGDISMGAPYAPCSGIHQRSICIYGIGDLHWILQNHHLLANKFDPKVDDNVLQCLEEYLRYKAIYGTEL*
13 >lcl|XP_003434186.1|Plus1complement(14607018..14608013) NW_876301 UDP-GalNAc:beta-1, 3-N-acetylgalactosaminyltransferase 1-like isoform 1 LOC100683634 __SEG__ Chr34 {Canis lupus familiaris} MALSLLTTLPSRMSLRSLKWSLLLLSLLSFLVMWYLSLPHYNVIERVNWMYFYEYEPIYRQDFRFTLREHSNCSHQNPFLVILVTSHPSDVKARQAIRVTWGEKKSWWGY
EVLTFFLLGQQAEKEDKMLALSLEDEHLLYGDIIRQDFLDTYNNLTLKTIMAFRWVTEFCPNAKYIMKTDTDVFINTGNLVKYLLNVNHSEKFFTGYPLIDNYSYRGFYQ
KAHISYQEYPFKVFPPYCSGLGYIMSIDLVPRIYEMMSHVKPIKFEDVYVGICLNLLKVDIHIPEDTNLFFLYRIHLDVCQLRRVIAAHGFSSKEIITFWQVMLRNTTCH
Y*
14 >lcl|XP_003434216.1|Plus110337367..10338362 NW_876302 N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, isoform B-like LOC100684157 __SEG__ Chr35 {Canis lupus familiaris} MPSSTRYLFIASVSCVVVFIVCYMLGPGGEQSFQKLNHSEALMLTQVCTSFIKGKAPFPWRNKLMIHQRTSCRDYLTRSHYITAPLSKEEADFALAYTMVIHHHFETFAR
LFRAIYMPQNVYCVHVDEKATAEFKDAVEQLLSCFPNAFLASRMEPVVYGGISRLQADLNCLKDLAASQVPWKYAINTCGQDFPLKTNKEIVRYLKGYRGKNITPGVLPP
SHAIGRTKYVHREHLGKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFTDFVLHDPRAVDLLQWSKDTFSPDEHFWVTLNRIPGMCDSVFHIMARGVLGKAFQEPGP
S*
15 >lcl|XP_003434435.1|Plus1complement(25006069..25007070) NW_876307 glyceraldehyde-3-phosphate dehydrogenase-like LOC100683724 __SEG__ Chr3 {Canis lupus familiaris} MVKVGVNGFGRIGRLVTRAAFNSGKVDIVTINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGKSISIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHL
KGRAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDHFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIP
ELNGKLTGMAFCVPTPNVSVVDLTCRLEKAAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNWVVDLMVHMA
SKE*
16 >lcl|XP_003435697.1|Plus13185541..3186542 NW_879563 glyceraldehyde-3-phosphate dehydrogenase-like LOC100688969 __SEG__ ChrX {Canis lupus familiaris} MVKVGVNGFGHIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHSKFHGTVKAENGKLVINGKSISIFQERDPANVKWGDAGAEYVVESTGVFTTMEKAGAHL
KGVAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDHFGIVEGLMTTVHAITATQKTVEGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIP
ELNGKLTGMAFRVPTPNVSVVDLTCRLEKAAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMVHMA
SKE*
17 >lcl|XP_003435708.1|Plus1complement(43980865..43981821) NW_879563 C1GALT1-specific chaperone 1-like LOC100685864 __SEG__ ChrX {Canis lupus familiaris} MLSESSSFLKGVMLGSIFCALITMLGHVRIGHGNRMYHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFES
IDMETNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDFEYVSVDGGIVLSIESMKRLNSLLSIPEKCPEQGGMIWKISED
KQLAVCLKYAGVFAENAEDSEGKDVFNTKSVGLFIKEAMTNHPNLVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHIFHDALVFLPPNGSDND*
18 >lcl|XP_531841.1|Plus145749827..45751020 NW_876251 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 B3GNT2 __SEG__ Chr10 {Canis lupus familiaris} MSVGRRRIKLLGILMMVNVFIYLIVEVSKSSSQEKNGKGEVIIPKEKFWKISAPPVAYWNREQEKLNRRYNPILNMLANQTGEVYGFSNISHLNFCEPDLRVMSVVSDFS
NLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLIPHFARRQAIRESWGRETNVGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNL
SLKEVLFLRWVSASCPNAEFVFKGDDDVFVNTHHILNYLNSLSKNKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYTGVYPPYAGGGGFLYSGHLALRLYNITDQVLLYP
IDDVYTGMCLQKLGLVPEKHKGFKTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSRLQSAHLNC*
19 >lcl|XP_531978.2|Plus1complement(42041659..42043803) NW_876253 uncharacterized family 31 glucosidase KIAA1161-like LOC474747 __SEG__ Chr11 {Canis lupus familiaris} MPQNPQEKSQAYPRRRPGSHADHRSPKAIAAAAMYTFLPDNFSPAKPKPSKELKPLLGSAVLGLLLVLAAVVAWCYYSASLRKAERLRTELLDLNRGGFSIRNQKGEQVF
RLAFRSGALDLDSCSREGALLGCSRTADGRPLHFFIQTVRPKDTVMCYRVRWEEAAPGRAVEHAMFLGDAAAHWYGGAEMRTQHWPIRLDGQQEPQPFVTSDVYSSDAAF
GGILERYWLSSRAAAIKVNDSVPFHLGWNSTERSLRLQARYHNTPYKPPAGGSAAPELSYRVCVGSDVTSIHKYMVRRYFNKPSRVPAPEAFRDPIWSTWVLYGRAVDQD
KVQRFAQQIRQHRFNSSHLEIDDMYTPAYGDFDFDEAKFPNASDMFRRLRDAGFRVTLWVHPFVNYNSSCFGEGVERELFVREPTGRLPALVRWWNGIGAVLDFTRPEAR
DWFQGHLRRLRSRYAVASFKFDAGEVSYLPRDFSTYRPLSDPSIWSRRYTEMALPFFSLAEVRVGYQSQNISCFFRLVDRDSVWGYDLGLRSLIPAVLTVSMLGYPFILP
DMVGGNAVSERTAGSSDVPERELYVRWLEVAAFMPAMQFSVPPWQYDAEVVAIAHKFAALRASLVAPLLLELAGEVTDTGDPIVRPLWWIAPGDETAHRIDSQFLIGDTL
LVAPVLEPGKQERDVYLPAGKWRSYKGELFDKTPVLLTDYPVDLDEVAYFIWAS*
20 >lcl|XP_532167.1|Plus1complement(17623205..17624458) NW_876254 phosphoglycerate kinase 2 PGK2 __SEG__ Chr12 {Canis lupus familiaris} MSLSKKLTLDKLDVKGKRVIMRVDFNVPMKKNQITNNQRIKASIPSITYCLDNGARSVVLMSHLGRPDGVPMPDKYSLEPVAAELKSLLSKDVLFLNDCVGPEVEKACAN
PATGSVILLENLRFHVEEEGKGQDSSGNKLKAEPDKIEGFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKASGFLMKKELDYFARALENPERPFLAILGGAKVADK
IQLIKNMLDKVNEMIIGGGMAFTFLKVLNNMDIGASLFDEEGAKIVKDIMAKAKSNGVNITFPVDFVTADKFQEDAKVGQATVASGIPAGWVALDCGPETNKRYAQVVAQ
AKLIVWNGPVGVFEWDAFAKGTKALMDEIVKATSRGCITIIGGGDTATCCAKWGTEDKVSHVSTGGGASLELLEGKVLPGVEALSNL*
21 >lcl|XP_534639.2|Plus1complement(4312053..4313054) NW_876282 glyceraldehyde-3-phosphate dehydrogenase-like LOC477441 __SEG__ Chr26 {Canis lupus familiaris} MVKVRVNGFGCIGRLVTRTAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLIINGKSISIFQERDPANIKWGDAGAEYVVESTGVFTTMEKVGAHL
KGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLSKIIHDHFGIVEGLITTVHAITATQKTVDGPSGKLWHDGRVAAQNIIPASTGAAKAMGKVIP
ELNRKLTGMVFHVPTPNVSVVDLTCCLEKAAKYDDIKKVVKQASEGPLKGILGYTEDPVVSCDFNSDTHSSTFDAGAGIALNDNFVKIISWYDNEFGYSNRVVDLMVHMT
SKE*
22 >lcl|XP_535625.3|Plus1complement(3695266..3696930) NW_876297 glycerol kinase 2 GK2 __SEG__ Chr32 {Canis lupus familiaris} MAAPKKTVVGPLVGAVVQGTNSTRFLVFSSKTADLLSHHQVELTEDFPREEWVEQDPKEILQSVYECIERTCQKLAELHIEVSNIKATGVSNQRETTVIWDKLTGEPFYN
AIVWLDLRTQPTLENLSKKIPGNNNFVKSETGLPLSTYFSAVKLRWILDNVRQVQKAVEEGRALLGTIDSWLIWSVTGGVNGGVHCTDVTNASRTMLSNIHSLEWDKELC
DFFDIPMDILRNVWSSSDIYGRIKAGSLEGEPISGCLGDQSAALVGQMCFQEGQAKNTYSTGRFLLCNTGHKCVFSAHGLLTTVAYKPGRDKPVCYALEGSVGIAGAVIR
WLRDNLGIINTSEEIETLAKDVGTSYGCYFVPAFSGLYAPFWEPSARGIICGLSQFTSKNHIAFAALESVCFQTREILDAMNYDCGIPLSHLQVDGAMTNNRILMQLQAD
ILHIPVIKPSMPETTALGAAMAAGAAEGVGVWSLKPEDLSVIFMERFEPQIKATESEIRYSTWKKAVRKSMGWVTTQYPESGDPTIFSCLPLGFFIVSSMIMLIGARYIS
GISY*
23 >lcl|XP_537434.1|Plus124094545..24095885 NW_876327 alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase MGAT2 __SEG__ Chr8 {Canis lupus familiaris} MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNEALAPPLLDAEPARGAGGRGGDHSAVSVGIRRGSNESAAPLVPAAPQPEADNLTLRYRSLVYQLNFDQTLRNVDKA
GSWAPRELVLVVQVHNRPDYLRLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAGVDFCPVLQVFFPFSIQLYPNEFPGSDPRDCPRDLEKNAALKMGCINAEYPDSFG
HYREAKFSQTKHHWWWKLHFVWERVKVLRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQEECPECDVLSLGTYTAIRSFHGIADKVDVKTWKSTEHNMGLALTRDAYQK
LIECTDTFCTYDDYNWDWTLQYLTVSCLPKFWKVLVPQVPRIFHAGDCGMHHKKTCKPSTQSAQIESLLNSNKQYLFPETLIISEKFVAAISPPRKNGGWGDIRDHELCK
SYRRLQ*
24 >lcl|XP_538343.3|Plus16292418..6293479 NW_876251 lactosylceramide 4-alpha-galactosyltransferase A4GALT __SEG__ Chr10 {Canis lupus familiaris} MSRPPECLLRLLRGAPRQRVCTLFIISFKFTFFVSIMIYWHIVGEPGGQREFPNLPADVPCPRLVPPTQLFSALPPGNIFFLETSDRTNPNFLFMCSVESAARAHPESRV
VVLMKGLPGGNASLPRHLGLSLLGCFPNVHMLPLDLEELFRDTPLAAWYAGRQRRWEPYLLPVLSDACRIALMWKFGGIYLDTDFIVLKNLHNLTNTLGAQSRYVLNGAF
LAFERHHEFMALCMRDFVAHYNGWIWGHQGPQLLTRVFKKWCSIRSLDESHACRGVTTLPCEAFYPIPWQDWKKYFQDISPEELHRLLNATYAVHVWNKKSQGTRLEATS
RALLAQLHARYCPTTHEAMKMYL*
25 >lcl|XP_538970.2|Plus122232696..22233682 NW_876254 glyceraldehyde-3-phosphate dehydrogenase-like LOC481849 __SEG__ Chr12 {Canis lupus familiaris} MVKLGVNEFAHIGRLGTRAAFNSGKEDIVTINDSFIDLNYMVYMFQYDSTHGKFYGMVKAENGKLVINGKSISIFQERHPANNKWGDAGAEYVVEPTGVFTTMENAGAHL
KSGAKRVIISAPSADAPMFVMGVNHEKYNKSLKIVSNASCTTNCLAPLAKVIHDHFGIVEGLMTTAHAITATQKTMGGTSGKLWPEGRVPVQNIIPASTGAATAVGKVIP
ELKGKFIGMAFRVPTPNMSVVDLTCPLEKAAKYDNIKKVVKQASEGPLKGILAEDQVVSCDFNSDTHPSIFDTGAGIAFNDHLVKLIIQYSSFSILLISLITYFIERP*
26 >lcl|XP_541274.2|Plus1complement(12447225..12448511) NW_876270 beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase GCNT1 __SEG__ Chr1 {Canis lupus familiaris} MLRTLLRRRLFSYPTKYYCLLLVFSVVTFSVLRIHQKPEFVSVGHLELVGENPSSNINCTKVLQGDVDEIQKVQLEILTVKFRQRPRWTTSDYINMTRDCNSFIKRRKYI
MEPLSKEEAEFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDKKSEDSFLAAVLGIASCFSNIFVASQLESVVYASWSRVQADLNCMQDLHRMSADWKYLINLCGMD
FPIKTNLEIVRKLKSLMGENNLETERMPSNKKERWKKHFTVVNGKLTNTGTDKMHPPLETPLFSGSAYFVVSRKYVEYVLKNEKIQKFMEWAKDTYSPDEYLWATIQRIP
EVPGSLSLSQKYDMSDMHAIARFVKWQYFEGDVSKGAPYPPCSGVHVRSVCVFGAGDLNWMLRKHHLFANKFDTDIDLFAIQCLDEHLRHKALETLKH*
27 >lcl|XP_541601.3|Plus142874974..42876167 NW_876270 LOW QUALITY PROTEIN: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 B3GNT8 __SEG__ Chr1 {Canis lupus familiaris} MRCPKCLLCLSALLTLLGLKVYIEWTSESRLSKAYWGPRGTAPGPTPASPEPTLPANLSARLGQTGPLLSAYWNQQQWQLGSLPRGDSTEPGGCRAWGAAAAAQIPDFAS
YPTDLQRFLLSAACRSFPQWRPGSGRGQVASCSGTDVPYLLLAVKSEPGHLRERQAVRETWGSPAPGVRLLFLLESPEGEGGPDLSSL*PRESHRYSDLLLWDFLDVSFN
QTLKDLLLLAWLGRHCPGVSFILQTRDDAFVHTPALLDHLQALPPSWARGLYLGEVFTQAKPFRKPGGPYYVPKSFFKGGYPAYASGGGYVIAGRLAPWLLQAAARVAPF
PFDDVYTGLCFRALGLAPRDHKGFLTAWPADRTADPCTLRDLLLAQPLSPQNSIRLWKQLQDPKLQC*
28 >lcl|XP_544891.3|Plus133698317..33699252 NW_876295 beta-1,3-galactosyltransferase 5 B3GALT5 __SEG__ Chr31 {Canis lupus familiaris} MAYLKMRLMYVSLVVLGALCLYFSMYGLIPFKGQPFVFKKERGSFLQLPDINCRQDPPFLVLLVTSSHEQVFVRTVIRNTWGKEKNVHGRPIKTFFLLGATASKDLSKVV
AQESQRHRDIIQKDFVDAYFNLTLKTMMGIEWIHRFCPQATFVMKTDSDMFVNVYYLTELLLKKNRTTRFFTGFLKLNEFPIRDKANKWFVSKYEYPWDKYPPFCSGTGY
VFSSDVASQVYNVSDSVPFIKLEDVFVGLCLAKLKIRLEELHSEQTFFPNGLPFSTCRFKKIVACHFVKPRNMLSYWQALENSLGEECPAV*
29 >lcl|XP_545508.2|Plus112773942..12774922 NW_876303 beta-1,3-galactosyltransferase 1 B3GALT1 __SEG__ Chr36 {Canis lupus familiaris} MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTFGNIRTRPINPHSFEFLINEPNKCEKSIPFLVILISTTHKEFDARQAIRETWGDENNFKGI
KIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVINGGPIRDVRSKW
YMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVITVHQISPEEMHRIWNDMSSKKHLRC*
30 >lcl|XP_546063.3|Plus131104859..31106223 NW_876308 beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 GCNT4 __SEG__ Chr3 {Canis lupus familiaris} MKTFKCCFKYPAQQKVFILFVTLWLFSLLKLLNVRSLLFPQRGIYLVEAFLSTSPFVRNRYTNVKNEVQYEVNCSGIYEQAPLEIGKSLEIRRKDIIDLDDEDVVAITSD
CDVYQSLRGYHQKPVSREEKSFPIAYSLVVHKDAIMVERLLHAIYNQHNIYCIHYDHKSPDTFKFAMNNLAKCFSNVFIASKLETVQYAHISRLQADLNCLSDLLKSSVQ
WKYVINLCGQDFPLKSNFELVSELKKLNGANMLETVKPPNSKMERFTYHHELRQVPYEYVKLPIRTNISKEAPPHNIEIFVGSAYFVLSRAFVKYIFNNSLVKDFFVWSK
DTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYHEGLLYPRCTGSHLRSVCIFGAAELRWLINEGHWFANKFDSKVDPILIKCLAEKLEEQQRQWITWS
SKKLFMAKNPMIAS*
31 >lcl|XP_546887.3|Plus115759513..15760727 NW_876316 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9-like B3GNT9 __SEG__ Chr5 {Canis lupus familiaris} MRRRLRLSGDASLTLLLGTALGLLLYAQREGAAPTTGAPRPQGEAEPGPTPGLRVFPAPDAGAAAAPPAYEGDTPEPPTPTGPFDFGRYLRAKDQRRFPLLINQPHKCRG
DGSPAGGPDLLIAVKSVAADFERRQAVRQTWGAEGRVQGALVRRVFLLGVPRGAGTDGADAEGEGPRSHWPALLRAESRAYADILLWAFDDTFFNLTLKEIHFLAWASAY
CPQVRFVFKGDADVFVHVGNLLAFLAPRDPAQDLLAGDVIVQARPIRTRASKYYIPEAVYGLPAYPAYAGGGGFVLSGVTLRRLADACAQVELFPIDDVFLGMCLQRLRL
TPEPHPAFRTFGIPRPSAAPHLRTFDPCFYRELVVVHGLSASDMWLMWRLLNGPQGPACARPWPVAAGSFQWGP*
32 >lcl|XP_548795.1|Plus1complement(116157..117500) NW_876252 alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase isoform 1 MGAT1 __SEG__ Chr11 {Canis lupus familiaris} MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPSPSRLPSDSALDDDPASLTREVIRLAEDAEVELERQRGLLQQIREHHARWSQRWRVPTAAPPAPPRVPVSSPPAVIPI
LVIACDRSTVRRCLDKLLHYRPSAEHFPIIVSQDCGHEETAQVIASYGSAITHIRQPDLSSITVPPDHRKFQGYYKIARHYRWALGQVFHKFKFPAAVVVEDDLEVAPDF
FEYFQATYPLLRADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPRAFWDDWMRRPEQRQGRACVRPEISRTMTFGRKGVSHGQFFDQH
LKFIKLNQHFVPFTQLDLSYLRQETYDRDFLARVYGAPLLQVEKVRTSERSELGEVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYRGIVSFLFRGRRVHLAPPQTWD
GYDPSWN*
33 >lcl|XP_848718.1|Plus11094501..1095475 NW_876292 probable UDP-sugar transporter protein SLC35A4 SLC35A4 __SEG__ Chr2 {Canis lupus familiaris} MSVEDGGMPGLGRPRQARWTLMLLLSTAIYGAHAPLLALCHVNGKVPFRPSSAVLLTELTKLLLCAFSLLVGWQAWPQGAPPWRQAAPFALSALLYGANNNLVIYLQRYM
DPSTYQVLSNLKIGSTALFYCLCLRHRLSARQGLALLLLMVAGACYAAGGLQDPGNTLPGSPLAVAAGPMPLHITPLGLLLLILYCLISGLSSVYTELLMKRQRLPLALQ
NLFLYTFGVLLNLGLHAGGGPGPGLLEGFSGWAALVVLSQAVNGLLMSAVMKHGSSITRLFVVSCSLVVNAVFSAALLRLQLTAAFFLATLLIGLAVRLYYGSR*
34 >lcl|XP_849233.1|Plus15873830..5875098 NW_876305 beta-1,3-galactosyltransferase 2 B3GALT2 __SEG__ Chr38 {Canis lupus familiaris} MLQWRRRHCCFAKMSWNAKRSLFRTHLIGVLSLVFLFAMFLFFNHHDWLPGRAGFKENPVTYTFRGFRSTKSETNHSSLRNIWKETVPQTLRPQTATNSNNTDLSPQGVT
GLENTLSANGSIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAEPGQTEARRAIRQTWGNESLAPGIQITRIFLLGVSIKLNGYLQRAILEESRQYHDIIQQEY
LDTYYNLTIKTLMGMNWVATYCPHIPYVMKTDSDMFVNTEYLIHKLLKPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKV
SLSIRRLHLEDVYVGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRKLH*
35 >lcl|XP_849606.1|Plus12529967..2530968 NW_876294 glyceraldehyde-3-phosphate dehydrogenase-like LOC487478 __SEG__ Chr30 {Canis lupus familiaris} MVKVGVNGFGHIGCLVTRAAFNSGRVDIVSINDPFIDFNYMVYMFQYDSTHGKFHHTVKAENGKLVINGKAISIFQERDPANIKWGDAGAEYVVESTGVFTTMEKTGAHL
KGRAKRVILSAPSSGAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDHLGIVEGLMTTVHAITATQKTMDGPSGKLWHDGRGTAQNIISASTGATKAMGKVIP
ELNRKLTGMAFHVPIPNVSVVDLTCRLEKAAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSDTYSSTFNAEAGIALNDHFVKLISWSDNEFSYSNWVVDLMVHMA
SKE*
36 >lcl|XP_849836.2|Plus1complement(1945566..1946918) NW_876284 major facilitator superfamily domain-containing protein 5 MFSD5 __SEG__ Chr27 {Canis lupus familiaris} MLVTAYLAFVVLLASCLGLELSRCRAKPPGRACSNPSFLRFQLDFYQVYFLALAADWLQAPYLYKLYQHYHFLEGQIAILYVCGLASTVLFGLVASSLVDWLGRKKSCVL
FSLTYSLCCLTKLSWDYFVLLMGRALGGLSTALLFSAFEAWYVHEHVERHDFPAEWIPATFARAAFWNHVLAVAAGVAAEAVACWMGLGPVAPFVAAIPLLALAGALALH
NWGENYDRQRAFSRTCAGGLRCLLSDRRVLLLGTIQALFESVIFIFVFLWTPVLDPHGAPLGIVFSSFMAASLLGSSLYRIATSKRYHLQPMHLLSLAVLIVVFSLFMLT
FSTSPGQESPVESFIAFLLIELACGLYFPSMSFLRRKVIPETEQAGVLNWFRVPLHLLACLGLLVLHDSDHKTGTRNMFSICSAVMVMALLAVVGLFTVVRHNAELRVPS
PTGEPYAPEL*
37 >lcl|XP_852677.1|Plus122159217..22160464 NW_876305 GPI mannosyltransferase 1 PIGM __SEG__ Chr38 {Canis lupus familiaris} MGRALGLRVRPAGVFGAAFVARVALVLYGAFQDRALLVRYTDVDYRVFTDAARLLSQGRSPYLRATYRYTPLLAWLLTPNVHLCEPFGKLLFISCDLLAAWPLYRLLLLR
GLGRRGACGYCALWLLNPLPMAVSSRGNADALVAALVLAALYLLARGRLACAAVAYGLAVHLKLYPVTYILPIALHLRRGAPPPAPAPAPAPRRARASALLRALCSRAVL
LFAAVAGLTFCALSLGFYRRYGWEFLEHTYLYHLTRRDIRHNFSPYFYMLYLTAESPWSPALGVAAFLPQLLLLSAASLAYYRDLAFCCFLHTAIFVTFNKVCTSQYFLW
YLCLLPLVMPQVRMPWKRAAGLLVLWFVGQALWLAPAYLLEFQGKNTFLFIWLAGLFFFLINCCILIQIISHYKEEPPAERVKCD*
38 >lcl|XP_853318.1|Plus1complement(32083477..32084478) NW_876297 glyceraldehyde-3-phosphate dehydrogenase-like LOC610683 __SEG__ Chr32 {Canis lupus familiaris} MVKVGVNRFGHIGHLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHSKFHGTVKAENGKLVINGKSISIFQERDPVNIKWGDAGAEYVVESTGVFTTMEKAGAHL
KGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDHFSIVEGLMTTVHAIPATQKTVDGPSGKLWCDGRGAAQNIIPASTGAAKAVGNVIP
ELNGKLTGMAFRDPTPNVSVVDLTCRLEKAAKYDDNKKVVKQASEDPLKGILGYTEDQVVSCDFNSDTHSSTFDVGAGIALNDHFVKLISWYDNEFCYSNRVVDLMVHMA
SKE*
39 >lcl|XP_868250.2|Plus1complement(26757465..26758559) NW_876272 fructose-bisphosphate aldolase A-like isoform 2 LOC476719 __SEG__ Chr20 {Canis lupus familiaris} MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIARRLQPIGTENTEENRRVYRQLLLTADDRVNPCIGGVILFHETLYQKTDDGRPFPQVIKSKGGIVGIKVD
KGVGALAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGQHTPSALAIMENANVLARYASICQQNGIVPMVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDH
HIYLEGTLLMPNMVTPGHACTHKYSPEEIAMATVTALRRTVPPAVTGITFLSGSQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYIK
RALANSLACQGKYTPSGQAGAAARESLFISNHAY*