SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau G    

ID / Description / Sequence
1 >lcl|NP_001015563.1|Plus11478159..1479430 NW_001494714 phosphatidylinositol glycan anchor biosynthesis, class M PIGM __SEG__ Chr3 {Bos taurus} MSPTTHWGDKFLNLRVPPAGVFVVAFFARVALIFYGIFQDRTLLVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYTPLLAWLLTPNIYLNELFGKFLFISFDLFTAFLL
YRLLLLKGLGRRQACGYCVFWLLNPLPMAVSSRGNADSIVASLVLMTLYLIEKRLVACAAVSYGFAVHLKMYPVTYILPIALHLLPERDSDEGLRQSRYSFQVRLYEFLK
RLCHRAVLLFVAVAGLTFFALSFGFYYRYGWEFLEHAYLYHLTRRDIRHNFSPYFYMLYLTAESKWSFSLGIAAFLPQFILLSAVSFAYYRDLVFCCFLHTSIFVTFNKV
CTSQYFLWYLCLLPLVMPLVRIPWRRAVVLLMLWFIGQALWLAPAYVLEFQGKNTFLFIWLAGLFFLLINCSILIQIISHYKEEPLTDRTKYD*
2 >lcl|NP_001015653.1|Plus1complement(1389830..1391173) NW_001495356 mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase MGAT1 __SEG__ Chr7 {Bos taurus} MLKKQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRLPSDSALDDDPASLTREVIRLAQDAEVELERQRGLLQQIREHHARWSQRWRVPTVAPPVPPRVPVTTPPAVIPI
LVIACDRSTVRRCLDKLLNYRPSAEHFPIIVSQDCGHEETAQVIASYGSAVMHIRQPDLSTIAVPPDHRKFQGYYKIARHYRWALGQVFHEFKFPAAVVVEDDLEVAPDF
FEYFQATYPLLRADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRQGRACVRPEISRTMTFGRKGVSHGQFFDQH
LKFIKLNQHFVPFTQLDLSYLRQETYDRDFLARVYGAPLLQVEKVRTSERSELQEVRVQYTSRDSFKAFAKALGVMDDLKSGVPRAGYRGIVSFLYRGRRVHLAPPQTWD
GYDPSWN*
3 >lcl|NP_001029747.1|Plus1complement(262298..263254) NW_001508680 C1GALT1-specific chaperone 1 C1GALT1C1 __SEG__ ChrX {Bos taurus} MLSESSSFLKGVMLGSIFCALITMLGHIRIGHGSRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCILLVRPKDVSLWAAVKETWTNHCDKVDFFSSENVKVFES
INMETNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTVKSGDLEYVSMEGGIVLSIESMKRLNSLLSIPEKCPEQGGMIWKISED
KQLAVCLKYAGVFAENAEDSEGKDIFNTKSVGLFIKEAMTNHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHVFNDALVFLPPNGSDND*
4 >lcl|NP_001030347.1|Plus1complement(5567..5809) NW_001493133 brain glycogen phosphorylase PYGB __SEG__ Chr13 {Bos taurus} MAKPLTDGERRKQISVRGLAGLGDVAEVRKSFNRHLHFTLVKDRNVATRRDYYLALAHTVRDHLVGRWIRTQQRYYERDPK
5 >lcl|NP_001039490.1|Plus1324921..326801 NW_001495131 transketolase-like 2 TKTL2 __SEG__ Chr6 {Bos taurus} MADSATLDATTVQVLQDLANRLRVHSIRATCASGSGHPTSCCSAAEIVSVLFFHTMRYRQTEPAHPDNDRFVLSKGHAAPLLYAAWVEAGSISEPDLLNLRTIHCDLEGH
PTPRLSFVDVATGSLGQGLGAACGMAYTGKYLDKASYRVFCLLGDGESSEGSVWEALAFASHYGLDNLVAVFDVNRLGQSGVAPLKHCTDIYRNRCEAFGWNTYLVDGHD
VEALCQAFSQAAQGKNKPTAIIAKTYKGRGIPNVEDAENWHGKPLPKERADEIIRLIKSQIKTNRNLLPKPPVEGSPPVSITNIKMTCLPDYKVGDKVATQKAYGLALAK
LGLANERVVVLDGDPKNSTFFEIFKKEHPERFIECFAAEQNMVSVALGCATRGRTITFVTTLGAFLTRAFDQIRMGAISQSNINLIGSHCGVSVGEDGPSQMALEDLAMF
RSIPNCTVFLPSDAVSTEHAVYLAANSEGMCFIRTNRSETAVIYTPQEHFEIGRAKVIRHSNNDKVTVIGAGVTLHEALAAADALSQQDISICVIDPFTIKPLDAATIIS
CAKATDGRVVTVEDHYQEGGIGEAVCAAVSGEPAIHVHQLSVSGVSERNRKPSELLSIFGVSARHIIAAVKYTLMN*
6 >lcl|NP_001039902.1|Plus145700..47361 NW_001494687 glycerol kinase GK __SEG__ Chr2 {Bos taurus} MAATKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPKEGWVEQDPKEILLSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKLTGEPLYN
AVVWLDLRTQSTVESLSKSIPVNNNFVKTKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEDRALFGTIDSWLIWSLTGGARGGVHCTDVTNASRTMLFNIHSLEWDKELC
EFFKVPMKILPNIRSSSEIYGLMKAGSLEGVPISGCLGDQSAALVGQLCFQDGQAKNTYGTGCFLLCNTGHKCVFSEHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVVR
WLRDNLGIIKTSEEIEKLANEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTNNKILMQLQAD
ILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAKESEIRYSTWKKAVMKSMDWATTKSSQNGDTGIFSSLPLGFFVVSSMVMLIGARYLS
GVP*
7 >lcl|NP_001068808.1|Plus1complement(1406191..1407543) NW_001495013 major facilitator superfamily domain-containing protein 5 MFSD5 __SEG__ Chr5 {Bos taurus} MLVTAYLAFVVLLASCLGLELSRCRAKPSGRACSNPSFLRFQLDFYQVYFLALAADWLQAPYLYKLYQHYHFLEAQIAILYVCGLASTVLFGLVASSLVDWLGRKKSCVL
FSLTYSLCCLTKLSRDYFVLLVGRALGGLSTALLFSAFEAWYIHEHLERHDFPTEWIPATFARAAFWNHVLAVAAGVAAEAVACWMGLGPVAPFVAAIPLLALAGALALH
NWGENYDRQRAFSRTCAGGLRCLLSDRRVLLLGTIQALFESVIFIFVFLWTPVLDPHGAPLGIIFSSFMAASLLGSSLYRIATSKRYHLQPMHLLSLAVLIVVFSLFMLT
FSTSPGQESPVESFIAFLLIELACGLYFPSMSFLRRKVIPETEQAGVLNWFRVPLHLLACLGLLVLHDSDRKTGTRNMFSICSAVMVMALLAVVGLFTVVRHDAELRVPS
PTGEPYTPEL*
8 >lcl|NP_001069508.1|Plus1complement(922310..923551) NW_001493616 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 B3GNT8 __SEG__ Chr18 {Bos taurus} MRCPKCLLCLSALLTLLGLKVYIEWTSEPRLGKAYPGPRSTLLGPTPASTEPTLPANLSARLGQTGPLPLAYWNQQQWRLGTLPGVNSTEAGDCGAWGAAAAAEIPDFAS
YPEDLRRFLLWAACRSFPPWLPTGGGGQVTGCEDPGDVPFLLLAVKSEPGRFAERQAVRETWGRPAPGVRLLFLLGSPVGQAGPDLSTLVSWESRRYGDLLLWDFLDVPF
NQTLKDLMLLAWLGRHCPGVSFVLQAQDDAFVRTPALLDHLRGLPPVRARGLYLGEVFIQAKPLRKPGGPFYVPGSFFEGSYPAYASGGGYVIAGRLAPWLLQAAARVAP
FPFGDVYTGLCFQALGLAPRTHKGFLTAWPADRTADPCAFRDLLLVRPLSPQDSIRLWKQLQDPGLQCRAPEAEAGRGGQGSP*
9 >lcl|NP_001069656.1|Plus11047581..1048849 NW_001493387 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase 2 B3GALT2 __SEG__ Chr16 {Bos taurus} MLQWRRRHCCFAKMSWNAKRSLFRTHLIGVLSLVFLFAMFLFFNHHDWLPGRAGFKENPVTYTFRGFRSTKSETNHSSLRNIWKETVPQTLRPQTATDPNNTDLSLQGVT
GLENTLGANGSIYNEKGTGHPNAYHFKYIINEPEKCQEKSPFLILLIAAEPGQIEARRAIRQTWGNESLAPGIQITRIFLLGVSIKSSGYLQRAILEESRQYHDIIQQEY
LDTYYNLTIKTLMGMNWVATYCPRIPYVMKTDSDMFVNTEYLIHKLLKPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKV
SLSIRRLHLEDVYVGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRKLH*
10 >lcl|NP_001069810.1|Plus1complement(2638049..2639254) NW_001493595 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 B3GNT9 __SEG__ Chr18 {Bos taurus} MRRRLRLRREALLTLLLGATLGLLLYAQQEGAAPTTSAPRAQGRAAPGPTPGLRVFQAPDTGAAPPAYEGDTPEPPTPTGPFDFGRYLRAKDQRRFPLLINQPHKCQGNG
AFPRGPDLLIAVKSVAADFERRQAVRQTWGAEGRVQGALVRRVFLLGVPRGTGTVAGEAEAGTQTHWSALLRAESRAYADILLWAFDDTFFNLTLKEIHFLAWASDYCPD
VRFVFKGDADVFVHVGNLLEFLAPRDPAQDLLAGDVIVQARPIRVRASKYYIPEAVYGLPAYPAYAGGGGFVLSGATLRRLAGACAQVELFPIDDVFLGMCLQRLRLTPE
PHPAFRTFGIPRPSAAPHLHTFDPCFYRELVVVHGLSAADIWLMWHLLHGPNGPACARPWPVPAGPFQWGP*
11 >lcl|NP_001073080.1|Plus15681280..5682254 NW_001495368 probable UDP-sugar transporter protein SLC35A4 SLC35A4 __SEG__ Chr7 {Bos taurus} MSVEDGGVPGLGRPRKARWTLMLLLSTAMYGAHAPLLALCHVDGRVPFRPSSAVLLTELTKLLLCALSLLVGWQAWPQGTPPWRQAAPFALSALLYGANNNLVIYLQRYM
DPSTYQVLSNLKIGSTALFYCLCLRHRLSARQGLALLLLMAAGACYAAGGLQDPGTTLPGPPSAAATSPMPLHITPLGLLLLILYCLISGLSSVYTELLMKRQRLPLALQ
NLFLYSFGVLLNLGLHAGGGPGPGLLEGFSGWMALVVLSQALNGLLMSAVMKHGSSITRLFVVSCSLVVNAVLSAALLRLQLTAAFFLATLLIGLAVRLYYGSR*
12 >lcl|NP_001091943.1|Plus1complement(3772724..3773290) NW_001495310 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 B3GNT3 __SEG__ Chr7 {Bos taurus} MRCSRPLRKEAGLALLLATFTLLLLSLHWSPPTCPHLKEPPRAPKAPDWPSPHFRAPPAPCQPNTSLMSLPDFAGQPPHIRDFLLYKHCRDFALLQEVPPDKCADPVFLL
LVIKSSPSNYERRELVRRTWGRERQILGVQLRRLFLVGTDSNPLEARKVNRLLAMEARTHEDILQWDFYDTFFNLTVKQ
13 >lcl|NP_001094697.1|Plus1complement(1796263..1797228) NW_001494189 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme GCNT2 __SEG__ Chr23 {Bos taurus} MPSPMRSLFIISVSCVIVFIVFCVFNFGGEQGFQRLNNSDTWVLTQVCTSLIKDKTPLLWRNKLMMYEKSSCEAYLTQSHYITAPLSKEEAEFRLAYIMVIHHNFDTFAR
LFRAIYMPQNVYCVHVDEKATVEFKDSVEQLLSCFPNAFLASKMEPVVYGGISRLQADLNCMKDLAASEVPWKYALNTCGQDFPLKTNREIVQYLKGFKGKNITPGVLPP
AHAVGRTKYVHREHLGKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFTNFVLHDPRALDLLQWSKDTFSPDEHFWVTLNRIPGMWDSLLHVKATFCT*
14 >lcl|NP_001096737.1|Plus1complement(648676..650289) NW_001495250 prosaposin-like 1 PSAPL1 __SEG__ Chr6 {Bos taurus} MLCALLLLPGVLCAALAGSISGPKECAKGPAVWCRDLQAATRCGAVGHCRVAIWSQPTARSLPCDLCLDVAATASNGLNPKAAETDVLAAVMKTCEWLPSQESLVKCKGM
VDAHGSAILSMLGGDLGSAPGQVCMALTLCQPLQRHPATPGPLSEEDIYDVVAPFVANGLLSSRRQRIAVGTVCQDCVRLVTRLQGALGPDLSSLAQVTTREQCESLGPG
LAFLCKNYIHQFFAPAEQTLRFMLPSEICRKEGFCEEWQGPPDSAHMAAVDGVPALELASPWRKGEVQMQGPVACDVCLQVVQRLDHWLESSSSKTIISQALERVCSVLP
PPVVRECIKLVDTYVPTVVDVLSRLTPEKMCTVIRLCRGWRRARAVHEGPTNPPPGLLDKDSLCRGCQQLFGVSVHNLEQKTTERRVLRAFKLACGILPLPFVMQCGRFV
SEYQPVLMMTLRDMMDPPTLCTKLRACRDPRDTLLGTDQCVLGPSFWCQSREAAQMCNMVEHCQRRVWKEAPSPAESAGDRGCPSQDPPPLERPASP*
15 >lcl|NP_001116507.1|Plus1complement(727855..729108) NW_001494160 phosphoglycerate kinase 2 PGK2 __SEG__ Chr23 {Bos taurus} MSLSKKLTLDKVDVKGKRVVMRVDFNVPMKKNQITNNQRIKASLPSIKYCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAAELKSLLGKDVVFLKDCVGPEVEKACAS
PATGTVILLENLRFHVEEEGKGQDPSGNKLKAEPDKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKASGFLMKKELDYFSKALENPERPFLAILGGAKVADK
IQLIKNMLDKVNEMIIGGGMAYTFLKVLNNMEIGASLFDEEGAKIVKEIMTKAGKNSVNITFPVDFVTADKFEENAKVGQATVASGIPAGWMGLDCGPETIKKYADVVGR
AKLIVWNGPVGVFEWDAFAKGTKALMDEVVKATSKGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVNALSNL*
16 >lcl|NP_777160.1|Plus1complement(1217709..1218788) NW_001495571 alpha-(1,3)-fucosyltransferase FUT9 __SEG__ Chr9 {Bos taurus} MTSASKGILRPFLIVCIILACFMVCLFIYIKPTNSWIFSPMESASSVLKMKNFFSTKTGDFNETTILIWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHH
RDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPNKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQ
AFGEYVTDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFW
ESHACLACDHVKRHQEYKSVGNLEKWFWN*
17 >lcl|NP_777161.1|Plus1complement(319919..321115) NW_001493280 fucosyltransferase 4 FUT4 __SEG__ Chr15 {Bos taurus} MRARWGRRGARRGGPGLPGTHLALLAASLLSTAVAIYVCWKQLPPLPWASPSPPRPVNVLLWWEPFRGRHNPRRPPPDCQRRFNISGCVLHTDRAAYEEAQAVLFHHRDL
VKGPPDWPPPWGVQMPPVEEREGLVMDDEGQEAEAETSAALGPRPPGQRWVWMNFESPSHSPGLQGLAGNIFNWTLSYRADSDIFVPYGYLYPRTHPSEQPPGLVPPLAR
KQGLVAWVVSNWDERQARVRYYRQLSQYVTVDVFGKGGPGQPLPDAELVHTVARYKFYLAFENSQHLDYITEKLWRNAFLAGAVPVVLGPNRTNYERFVPSNAFIHVDDF
PSASSLAAHLQFLDRNPTVYRGYFRWRRSHAVHVTSFWDEPWCLACQAVQKAGNQRKSVPNLAGWFQQ*
18 >lcl|NP_803476.1|Plus16647051..6648337 NW_001495453 glucosaminyl transferase 1, core 2 GCNT1 __SEG__ Chr8 {Bos taurus} MLRKLWRRKLFSFPTKYYFLFLAFSVVTFTVLRIHQKTEFVNFGHLELFEENPSSNINCTKILQGDVDEIQKVKLESLTVKFKKRARWTNYDYINMTGDCASFIKKRKYI
TEPLSKEEAGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDAKSEKSFLAAAVGIASCFSNVFVASQLESVVYASWSRVQADLNCMQDLYQMNAGWKYLINLCGMD
FPIKTNLEIVRKLKLLMGENNLETEKMPSHKKERWKKHYEVVNGKLTNMGTDKIHPPLETPLFSGSAYFVVSREYVEYVLQNQNIQKFMEWAKDTYSPDEYLWATIQRIP
EVPGSLSLSYKYDTSDMQAIARFVKWQYFEGDVSKGAPYPPCSGVHVRSVCVFGAGDLNWLLHVHHLFANKFDTDIDLFAIQCLDEHLRHKALETLKP*
19 >lcl|NP_991378.1|Plus1complement(3721777..3723099) NW_001492827 beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 GCNT3 __SEG__ Chr10 {Bos taurus} MKMTGWKKKLCRGHHLWALGCYMLLAVVALRLSLRLKCDVDSLDLESRDFQSQRCRDVLYKNLKLPAKRSISCSGITRGDQEAVVQALLDNLEVKKKRLPFTDTYYLNIT
RDCEQFKAQRKFIQFPLSKEELDFPIAYSMVVHEKIENFERLLRAVYAPQNIYCVHVDVKSPETFKEAVKAIISCFPNVFMASKLVPVVYASWSRVQADLNCMEDLLQSS
VPWKYLLNTCGTDFPIKTNAEMVLALKMLNGKNSMESEIPSEYKKNRWKYRYEVTDRLYLTSKMKDPPPDNLPMFTGNAYFVASRAFVQHVLENPKSQRLIEWVKDTYSP
DEHLWATLQRAPWMPGSVPYHPKYHISDMTAIARLVKWQGHEGDVSMGAPYAPCSGIHQRAICIYGAGDLHWILQNHHLLANKFDPRVDDNVLQCLEEYLRHKAIYGTEL
*
20 >lcl|XP_001250503.1|Plus11044150..1044704 NW_001495310 glyoxalase I-like GLO1 __SEG__ Chr7 {Bos taurus} MAEPQPKSGGLTNKAALSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRILGMTLLQKLDFPTMKFSLYFLAYEDKNDIPKDKDEKVAWVFSRKATLELTHNWGTEDD
ETQSYHSGNSDPRGFGHIGIAVPDVHGACKRFEELGVKFVKKPDDGKMKGLAFIQDPDVYWIEILNPNTMITII*
21 >lcl|XP_001250806.1|Plus1complement(75249..76613) NW_001848863 glucosaminyl transferase 4, core 2 GCNT4 __SEG__ Chr10 {Bos taurus} MKTFKCCFKYHLQQKVFILFLTLWLLSLLKLLNVKRFLFPERGIYLVEYSLSTSPFVRNRYTHVKNEIGYEINCSGVYEQEPLEIGKSLEIRRRTIIDLDDDDVVAITSD
CEIYQALRSYDEKLVSEEEKSFPIAYSLVVHKDAIMVERLILAIYNQHNIYCIHYDQKSSDTFKVAMNNLAKCFSNIFIASKLETVQYAHISRLQADLNCLSDLLKSSVQ
WKYVINLCGQDFPLKSNFELVSELKKLNGSNMLETVKPPSTKTERFTYHHELKQAPYEYVKLPMRTNISKEAPPHNIEIFVGSAYFVLSRAFVKYIFNNSFVKDFFAWSK
DTYSPDEHFWATLIRVPGIPGEISKTAQDVSDLQSKTRLVKWNYLEGLFYPSCTGSHLRSVCIYGAAELRWLMKYGHWFANKFDSKVDPILIKCLAEKLEEQQRKWITLS
SAKLFMAKPSVTTS*
22 >lcl|XP_001252171.1|Plus1complement(3733898..3734371) NW_001495368 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2-like LOC784359 __SEG__ Chr7 {Bos taurus} MFKGNDVVFVNTHHLLNYLNSLSGNKAKDLFIGDVIHNAGPHQDKKLKYYIPKVVYTGVYPPYAGGGGFLYSGHLALRLYNVTDRVLLYPIDDVYTGMCLQKLGLAPERH
KGFRTFDIEEKSRSNICSYVDLMLVHSRKPQEMIDIWSRLQSAHLKC*
23 >lcl|XP_001787720.1|Plus11102114..1102623 NW_001494687 succinate dehydrogenase cytochrome b560 subunit, mitochondrial-like isoform 1 SDHC __SEG__ Chr2 {Bos taurus} MAALLLRHVGRHCLRAHLSPQLCIRNAVPLGTTAKEEMERFWSKNTSLNRPLSPHISIYGWSLPMAMSICHRGTGIALSAGVSLFGLSALLVPGSFESHLEFVKSLCLGP
ALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLTISQLHQSGEAVLVLTVLSSVGLAAM*
24 >lcl|XP_001787826.1|Plus1complement(1348777..>1349556) NW_001495356 mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase-like LOC788585 __SEG__ Chr7 {Bos taurus} RHYRWALGQVFHEFKSPAAVVVEDDLEVAPDFFEYFQATYPLLRADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPE
QRQGRACVRPEISRTMTFGRKGVSHGQFFDQHLKFIKLNQHFVPFTQLDLSYLRQETYDRDFLARVYGAPLLQVEKVRTSERSELQEVRVQYTSRDSFKAFAKALGVMDD
LKSGVPRAGYRGIVSFLYRGRRVHLAPPQTWDGYDPSWN*
25 >lcl|XP_002702356.1|Plus1complement(645411..645626) NW_001493760 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1-like LOC100336374 __SEG__ Chr1 {Bos taurus} MDIYEFLPSKHKTDVCYYYQRYFDSACTMGSYHPLLFEKNMVKHLNLGTDKDIYLLGKATLPGFWTIHCRA*
26 >lcl|XP_591790.2|Plus1complement(2073125..2074789) NW_001495218 glycerol kinase 2 GK2 __SEG__ Chr6 {Bos taurus} MAAPKTAAGGPLVGALVQGTDYSNFMVFNSKTSEVLSHHRVELTQEVPKEGWIEQDPKQILQSVNECIEKTCEKLQELNIDISNIKAIGVSNQRETTVVWDKLTGEPLYN
AVMWLDVRTQSTVETLSKKIPGNNNFVKSKTGLPLSTYFSAVKLRWILDNVRKAQKAVEEGRALFGTVDSWLIWSLTGGVDGGIHCTDVTNASRTMLFNIHSLEWDKELC
DFFEIPMDILPNIWSSSEIYGRVKTGTLEGVPISGCLGDQSAALVGQMCFQEGQAKNTYGTGCFLLCNTGHKCVFSECGLLTTVAYKLGKNKPVFYALEGSVAIGGAVIH
WLRDNLGIIKTSEESEKLAKEVGTSYGCYFIPAFSGLYAPYWEPTARGIICGLTQFTNKSHIAFAALEAICFQTREILDAMNRDCGIPLSHLQVDGEMTNNKVLMQLQAD
ILHIPVIKASMPETMALGAAMAAGAAEGVNVWSLKPEDLSTIMMERFEPQIKATESEIRYSTWKKAVMKSMGWVTGQPSESSEANNFSSLPLGFFIVTSMIMLIGARYIS
SIFS*
27 >lcl|XP_600686.1|Plus1complement(1872260..1873249) NW_001493430 beta-1,3-galactosyltransferase 6-like B3GALT6 __SEG__ Chr16 {Bos taurus} MKLLRRAWRHRTALGLGGLAMGGVALLYLARCAAPPDSALSGPAAPAPVGPARAAAFLAVLVASAPRAAERRSVVRSTWLAARRGGPGDVWARFAVGTSGLGDEERRALE
REQAQHGDLLLLPGLRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDSFARLDAVLAELRARDPARRRRLYWGFFSGRGRVRPGGRWREAAWQLCDYYLPYALGGGYVL
SADLVRYLRLSREYLRAWHSEDVSLGAWLAPVDVQREHDPRFDTEYKSRGCNNQYLVTHKQSLEDMLEKHRTLTHEGRLCKREVQLRLSYVYDWSAPPSQCCQRKEGIP*
28 >lcl|XP_607425.2|Plus1complement(1825050..1827194) NW_001495473 CG14476-like LOC528987 __SEG__ Chr8 {Bos taurus} MPQNSQENSQAYPRRRSGSHTGRKTPETLAAATMYTFLPDNFSPTKPKPSKELKPLLGSAVLGLLLVLAAVVAWCYYSASLRKAERLRAELLDLNRGGFSIRNQKGEQVF
RLAFRSGVLDLDSCSRDGALLGCSRTADGRPLHFFIQTVRPKDTVMCYRVRWEEAAPGRAVEHAMFLGDAGAHWYGGAEMKTQHWPIRLDGQQEPQPFVTSDVYSSDAAF
GGILERYWLSSRAAAIKVNDSVPFHLGWNSTERSLRLQARYHDTPYKPPAGRAAAPELSYRVCVGSDVTSIHKYMVRRYFNKPSRVPAPEAFRDPIWSTWVLYGRAVDQD
KVQRFAQQIRQHRFNSSHLEIDDMYTPAYGDFDFDEAKFPNASDMFRRLRDAGFRVTLWVHPFVNYNSSRFGEGVERELFVREPTGRLPALVRWWNGIGAVLDFTRPEAR
DWFQGHLRRLRSRYSVASFKFDAGEVSYLPRDFSTYRPLSDPNIWSRRYTEMALPFFSLAEVRVGYQSQNISCFFRLVDRDSVWGYDLGLRSLIPAVLTVSMLGYPFILP
DMVGGNAVSERSTSGGDVPERELYVRWLEVAAFMPAMQFSVPPWRYDAEVVAIAHKFTALRASLVAPLLLELAGEVTDTGDPIVRPLWWIAPGDETAHRIDSQFLIGDTL
LVAPVLEPGKQERDVYLPAGKWRSYKGELFDKTPVLLTDYPVDLDEIAYFIWVS*
29 >lcl|XP_610387.2|Plus1complement(1086433..1087404) NW_001508689 hypothetical protein LOC531884 __SEG__ ChrX {Bos taurus} MPCPFPDSTYVSYSPDHWPLCFVHRNFHYITILRDPVSRYLSEWRHVQRGATWKASLHVCDGRPPTSEELPSCYTGDDWSGCPLKEFMDCPYNLANNRQVRMLSDLTLVG
CYNLSVMPEKQRNKVLLESAKSNLKHMAFFGLTEFQRKTQYLFEKTFNMNFISPFTQYNTTRASSVEINDELQKRIEGLNFLDMELYSYAKDLFLQRYQFMRQKEHQEAR
RKRQEQRKFLKGRFLQTHYQTQSQGQNPNPSQNPSQNPNLNASQSGTQNLFQNLIQNLTQSSGQNPSPKENQESQKQNSGQEQSDGNTSNGTHDYIGSVEKWR*
30 >lcl|XP_871590.1|Plus1complement(35810..36469) NW_001508783 solute carrier family 16 (monocarboxylic acid transporters), member 2-like LOC614855 __SEG__ ChrX {Bos taurus} MGRGGGGLDGGGGVEGSRDRLSRDRLASWGAEPGGGGGSSSSAWSSSSRNKYQPQSGSSGPSSHSPPAAMALQSPASEEAKGPWREADQEQQKPVGSPEPEPEPVPVPPP
EPQPEPQPEPQPLPDPAPLPELEFEPEPMHEPDPTPTVETRGTARGFQPPEGGFGWMVVFAATWCNGSIFGIQNSFGILYSMLLQEEREKNRQVEFQAGERPRAPHLAF*
31 >lcl|XP_871608.2|Plus12270620..2271555 NW_001493780 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase 5 B3GALT5 __SEG__ Chr1 {Bos taurus} MAYVKMRWVYISLMVLGVFCLYYNLEDLNPFKGEPVIFKNELGDFLQLPDIDCGQDPPFLILLVASSHEQWFVRLVIRSTWGKEKIIKGKRIKTFFLLGTSPSKHISREV
AKESQKFRDIIQKDFTDDYFNLTLKTMMGMQWIYSFCPQTTFVMKTDSDMFVNIYYLTELLLKKNRTTRFFTGFLKLNEYPIRKRFNKWFVSKYEYPWDKYPPFCSGTGY
VFSSDVAGEVYHVANSVPFIKLEDVFVGLCLKRLKIRLEELHSEQTFFPDGLPFTTCRYKKIVASHHIKPRDILRYWQALEGSLPEECPDN*
32 >lcl|XP_873371.2|Plus1complement(1624457..1625530) NW_001493523 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 B3GNT4 __SEG__ Chr17 {Bos taurus} MFHKVGWLVLYSLAVLLLSCLFLLKKEAQPAGGPVARQPFWAPPGLRRSPCLPNHTVANASLFLPTRHRLFLTYRHCRNFSILLEPSGCAEDTFLLLAIKSQPGHVERRA
AIRSTWGRAGSWAKGRQLKLVFLLGLAGPAPPAQLLAYESREFDDILQWDFAEDFFNLTLKELHLQRWVAAACPQANFILKGDDDVFVHIPNVLEFLDGWDPAQDLLVGD
VIRQALPNRNTKVKYFIPPSMYRARHYPPYAGGGGYVMSRATVQRLQLAVEEAELFPIDDVFVGMCLRKLGVSPMHHAGFKTFGIRRPLNPLDPCLYRGLLLVHRLNPLE
MWTMWSLVIDEGLKCAAAPLSQLPGVG*