SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr F    

ID / Description / Sequence
1 >lcl|XP_003130238.1|Plus1complement(5804695..5805651) NW_003535584 ribose-phosphate pyrophosphokinase 1-like LOC100515567 __SEG__ Chr9 {Sus scrofa} MPNIKIFSGSSHQDLSQKIAGRLGLKLGKVVTKKFSNQETCVEIGESVRGEDVYIMQSGCGEINDNLMELLIMINACKTASASRVTAVIPCFPYARQDKKDKNQAPISAK
LVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENISEWRNCTIVSPDADGAKRVTSIADRLNVDFALIHKEKKKANEVNRMVLVGDVKDRVAILVD
DIADTCGTICHAADKLLSAGAIRVYAILSHGIFSGPAITHINSACFEAVVVTNTIPQEDKMKRCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL*
2 >lcl|XP_003355287.1|Plus1complement(46170..46484) NW_003534686 membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3-like LOC100625849 __SEG__ Chr4 {Sus scrofa} MSKTLKKKKHWLSKVQECAVSWAGPPGDLGSEIRGGAERGEFPYLGRLREEPGGGTCCVVSGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKP