SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor F    

ID / Description / Sequence
1 >lcl|NP_001009694.1|Plus124633709..24634665 NW_047760 ribose-phosphate pyrophosphokinase I -like LOC314140 __SEG__ Chr6 {Rattus norvegicus} MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAK
LVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWKNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVD
DMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL*
2 >lcl|NP_001099148.1|Plus1593552..594508 NW_047760 phosphoribosyl pyrophosphate synthetase 1-like 1 Prps1l1 __SEG__ Chr6 {Rattus norvegicus} MPNIKIFSGSSHQDLSQKITERLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDSLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPMSAK
LIANMLSIAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENISDWRNCTIVSPDAGGAKRVTSIADHLNVDFALIHKERKKANEVDRMVLVGDVKERVAILVD
DMADTCGTICYAADKLLSEGATRVYAILTHGIFSGPAIARINGACFEAVVVTNTIPQEDKMKQCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL*
3 >lcl|XP_002729985.1|Plus111227023..11227385 NW_047800 rCG25068-like LOC100362456 __SEG__ Chr8 {Rattus norvegicus} MTVSDIMGFCEAMTNDSKIMVVDTLKETFQSNVFCSTLKLVLAKSCLTMASMCLECFPEAAYTKWLGLRKKVGVISTKPKATPCTASATFRSLLSSPLCLESHGRSLVPG
SSPPSAGLAV*
4 >lcl|XP_227632.4|Plus1complement(24152291..24152761) NW_047627 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase-like RGD1559750 __SEG__ Chr2 {Rattus norvegicus} MCHIGAGQQSRIHCTRLAGDKANSWWLQHHPRVLSMKFKAGVKRAEVSNAIDQYVASTIGEGDNLVKWKTLFEEAPEFLTEAEKKEWVDKLNGVSVSSDAFFPFRDNVDR
AKRSGVAYIVTPSGSTADKAVIEVCVTSWGSCWLIQISGSSTPDLG*
5 >lcl|XP_575395.1|Plus112756826..12757524 NW_047689 adenylate kinase 2, mitochondrial-like RGD1562178 __SEG__ Chr4 {Rattus norvegicus} MAPNALAPEPEHPKGIWAVLLVPARAGKGTRASKLAENFCVCHLATGDMLRVMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVKQAEM
LDDLMDKRKEKLYSVIEFSIQDSLLILRITGRLIHPKSGRSYHEEFNPPKEAMKDDITGEPLIRRSDDNKKALKTLLEAYHTQTTPLVEYYRKRGFHCAIDASQTPDVVF
ASILAAFSKATS*