SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ptro F    

ID / Description / Sequence
1 >lcl|XP_003312657.1|Plus17106265..7107047 NW_003457573 deoxycytidine kinase-like LOC450470 __SEG__ Chr10 {Pan troglodytes} MATPPKRSCPSVSASSEGTRIKKISIEGNIAADKSTFVNILKQLCEDWEVVPEPVARRCNVQSTQDEFEELTTSQKNGGNVLQMMCKKPERWSFTFQTYACLSRIRAQLA
SLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRATPEKCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRT
LKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL*
2 >lcl|XP_003317852.1|Plus112194..12508 NW_003459840 membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3-like LOC100613254 __SEG__ Chr1 {Pan troglodytes} MSKTLKKKKHWLSKVQECAVSWAGPPGDFGAEISGGAERGEFPYLGRLREEPGGGTCCVVSGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKP
3 >lcl|XP_528013.1|Plus1complement(14787072..14788028) NW_003457175 ribose-phosphate pyrophosphokinase 3 PRPS1L1 __SEG__ Chr7 {Pan troglodytes} MPNIKIFSGNSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIDESVRGEDVYIVQSGCGEINDSLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAK
LVANMLSIAGADHIITMDLHASQIQGFFDIPVDNLYAEPTVLRWIRENISEWKNCIIVSPDAGGAKRVTSIADQLNVDFALIHKEQKKANEVDCMVLVGDVNDRVAILVD
DMADTCGTICLAADKLLSAGATRVYAILTHGIFSGPAISRINTACFEAVVVTNTIPQDDNMKHCSKIRVIDISMILAEAIRRTHNGESVSYLFSHVPL*