SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus F    

ID / Description / Sequence
1 >lcl|NP_001032835.2|Plus115664627..15665583 NT_039551 hypothetical protein LOC328099 Gm5081 __SEG__ Chr12 {Mus musculus} MSNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAK
LVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVD
DMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL*
2 >lcl|NP_083570.1|Plus132669560..32670516 NT_039548 phosphoribosyl pyrophosphate synthetase 1-like 1 Prps1l1 __SEG__ Chr12 {Mus musculus} MPNIKLFSGSSHQDLSQKITERLGLELSKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDSLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAK
LVANMLSIAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENISDWRNCTIVSPDAGGAKRVTSIADHLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVD
DMADTCGTICYAADKLLSEGATRVYAILTHGIFSGPAIARINGACFEAVVVTNTIPQEDKMKQCSKIQVIDIAMILAEAIRRTHNGESVSYLFSHVPL*