SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmul F    

ID / Description / Sequence
1 >lcl|XP_001083089.1|Plus12011326..2011946 NW_001118162 adenylate kinase isoenzyme 4, mitochondrial-like LOC694395 __SEG__ Chr5 {Macaca mulatta} MEVLESFTKKVLSTEVGEMAKQYMEKSLLVPDHMITRLMMSELENRPGQHWLLDGFPRTLGQAEALDKICEVDLVISLNISFETLKDHLSRHWIHPPSGRVYNLDFNPPH
VYGIDDVTGEPSVQQEDDKPEAVAARLRQYKDVAKPVIELHKSRGVFHQYSSGTETNKIWPYVYALFSNKITPIQSKGAYRPCPVEEPGRCGRPFN*
2 >lcl|XP_001085393.1|Plus1complement(841937..843478) NW_001218112 inosine-5'-monophosphate dehydrogenase 1 isoform 3 IMPDH1 __SEG__ ChrX {Macaca mulatta} MADYLISGGTLYVPEDGLTAQQLFASADGLTYDDFLILPGFIDFLTGEVDLTSALTRKITLKTPLISFPTDTVTEADMAIAMALMGGIGFIHHNCTPEFQANKVQKVKKF
EQGFITDPVVLSPSHTVGDVLEAKVRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTFEEANEILKRSKKGKLPVVNDHDELVA
IIARTNLKKNRDYPLASKDSHKQLLCGAVVGTREDDKFRLDLLTQAGVDVIVLDSSQGNLVYQIAMVHYTKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLHVGMGCGSI
CITPEVMACGRIHGSAVYKVAEYARRFGVPIIADGGIQTLGHVVKALALGASTVMMGSLLAATTEASAEYFSDGVPLKKYQGMGSLDAMEKSSSSQKRYFSEGDKVKFAQ
SISGSIRDKGFIQKFVPYLIAGIQHSCQDIGARSLSVLRSMMYSGELKFEKRTVSAQMEGGVHGLHSYEKRLY*
3 >lcl|XP_001092713.1|Plus18698303..8698989 NW_001122913 UMP-CMP kinase-like isoform 1 LOC700256 __SEG__ Chr8 {Macaca mulatta} MLSRCRSRLLHVLGLSFLLQTRRPILFCPPRLMKPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQ
TMAANAHKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGSSDDNRESSEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEV
VQIFDKEG*
4 >lcl|XP_001104622.1|Plus11089501..1090370 NW_001218176 purine nucleoside phosphorylase NP __SEG__ ChrX {Macaca mulatta} MENRYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPQSTVPGHVGRLVFGFLNGRACVIMQGRFHMYEGYSLWKVTFPVRVFHLLGVDT
LVVTNAAGGLNPEFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGVRFPAMSDAYDRTMRQRALSMWKQMGEQRELQEGTYVMLAGPSFETVAESRLLQKLGADAVGMS
TVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLVAGKQAAQKLEQLVSILMASIPLPDKAS*
5 >lcl|XP_001105054.1|Plus12502943..2503899 NW_001114278 ribose-phosphate pyrophosphokinase 3 PRPS1L1 __SEG__ Chr3 {Macaca mulatta} MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIDESVRGEDVYIVQSGCGEINDSLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAK
LVANMLSIAGADHIITMDLHASQIQGFFDIPVDNLYAEPTVLKWIRENISEWKNCTIVSPDAGGAKRVTSIADQLKVDFALIHKERKKANEVDCMVLVGDVNDRVAILVD
DMADTCGTICLAADKLLSAGATRVYAILTHGIFSGPAISRINTACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL*
6 >lcl|XP_002798482.1|Plus1complement(<1234..1386) NW_001096348 adenylosuccinate lyase-like LOC100424056 __SEG__ Chr10 {Macaca mulatta} MAAVGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQ
7 >lcl|XP_002798483.1|Plus1<343..573 NW_001096350 adenylosuccinate lyase-like LOC100424161 __SEG__ Chr10 {Macaca mulatta} TLGLPITDEQIQEMKSNLDNIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTVGARVVYT*