SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom F    

ID / Description / Sequence
1 >lcl|XP_001362526.1|Plus1complement(891971..892486) NW_001581911 adenylate kinase isoenzyme 6-like LOC100011524 __SEG__ Chr3 {Monodelphis domestica} MRLPNILLTGTPGVGKTTLGKELASRTGLKYVNVGDLAQEGQLYDGFDEEYVYPILDEDRVVDELENKMKEGGVIVDYHGCDFFPERWFHIVFVLQTDNSVLYTRLEKRG
YSIKKLQDNVQCEIFQILYEEAMASYKPEIVHRLPSNVPEELESNLDQIIKWIEEWIKDNN*
2 >lcl|XP_001362803.1|Plus1complement(16660928..16661443) NW_001581970 adenylate kinase isoenzyme 6-like LOC100011389 __SEG__ Chr5 {Monodelphis domestica} MRLPNILLTGTPGVGKTTLGKELASRTGLKYVNVGDLAQEGQLYDGFDEEYEYPILDEARVADELENKMKEGGVIVDYHGCDFFPEQWFHVVFVLQTDNSVLYTRLEKRH
YSVKKLQHNVQCEIFQILYEEAMASYKPEIVHWLPSNVPEELKSNLDQVIKWIEEWIKDNN*
3 >lcl|XP_001363706.1|Plus14901547..4902503 NW_001581963 ribose-phosphate pyrophosphokinase 2-like LOC100012872 __SEG__ Chr4 {Monodelphis domestica} MPNILLFSGNSHQDLSQKVADRLGLKLGKVVSTKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLLMINACKIASSSRVTAVIPCFPYARQDKKDKSRVPISAK
LVANMLSVAGADHIITMDLHASQIQGFFDIPVDNMYAEPAFLQWIQKNITEWRNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKNRVAILVD
DIADTCGTICHAADKLLSAGATKIYAIVTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMDRCSKIQVIDISMILAETIRRTHNGESVSYLFSQVPL*
4 >lcl|XP_001364963.2|Plus1complement(1290404..1291276) NW_001582021 purine nucleoside phosphorylase-like LOC100011206 __SEG__ Chr8 {Monodelphis domestica} MEHEFRYEDYKETAEWLLAHTEHRPQIAVICGSGLGDLANRVTQMQAFDYSEIPNFPQSTIPGHAGRLVFGYLKDKCCVMMQGRFHMSEGYALWKVAFPVRVFRLMNVHT
LIVTNAAGGLNPEYEVGDIMLIRDHINLPGLGGQNPLSGPNDNRFGERFPPMSDAYDRVLRQKAHGIWKQMDQDRPLQEGTYVMVGGPNFETIAECRFLQKIGADAVGMS
TVPEVIAARHCGLQVFGFSLITNKSILDYETHQTANHEEVLMAGQQAAKKLEKFVGILVEIMQPPAEETF*
5 >lcl|XP_001368151.1|Plus137527482..37528186 NW_001581837 thymidine kinase, cytosolic-like LOC100019974 __SEG__ Chr1 {Monodelphis domestica} MNCINVPTMLPSSPSKVRGQIQVILGPMFSRKSTELMHRVQRFQIAQYKCLVIKYTKDTRYSKNFSTHDQNTMEALPACLLWDVAQNALAVTVIGIDEGQFFPDIVEFSE
TMANAGKTIIVAALDGTFQRKALGNILNLMPLTESMVKLIAVCMECFREAAYTKRLGMEKEVEVIGGADKYHSVCRLCYFKKVSGQSTGLENKENCPQSGKPGDTTSYQK
LFPTQQILQCSSSN*
6 >lcl|XP_001368604.1|Plus1complement(1428644..1429516) NW_001581881 purine nucleoside phosphorylase-like LOC100014297 __SEG__ Chr2 {Monodelphis domestica} MEHEFRYEDYKETAEWLLAHTEHRPQIAVICGSGLGDLANRVTQGQAFAYSEIPNFPQSTVPGHAGRLVFGYLKDKCCVMMQGRFHMYEGYPLWKVTFPVRVFRLMNVHT
LIVTNAAGGLNPEYEVGDIMLIRDHINLPGLGGQNPLSGPNDNRFGGRFPPMSDAYDRVLRQKAHGIWKQMDQDRPLQEGTYVMVGGPNFETIAECRFLQKIGADAVGMS
TVPEVIVARHCGLRVFGFSLITNKSILDYATRETANHEEVLMAGQQAAKKLEKFVCVLVENMQPPAEETF*
7 >lcl|XP_001368636.1|Plus11432405..1433277 NW_001581881 purine nucleoside phosphorylase-like LOC100014324 __SEG__ Chr2 {Monodelphis domestica} MEHEFRYEDYKETAEWLLAHTEHRPQIAVICGSGLGNLANRVTQGQAFAYSEIPNFPQSTVPGHAGRLVFGYLKDKCCVMMQGRFHMYEGYPLWKVTFPVRVFRLMNVHT
LIVTNAAGGLNPEYEVGDIMLIRDHINLPGLGGQNPLSGPNDNRFGGRFPPMSDAYDRVLRQKAHGIWKQMDQDRPLQEGTYVMVGGPNFETIAECRFLQKIGADAVGMS
TVPEVIVARHCGLRVFGFSLITNKSILDYATRETANHEEVLMAGQQAAKKLEKFVCILVENMQPPAEETF*
8 >lcl|XP_001370978.1|Plus17578473..7579144 NW_001581928 hypoxanthine-guanine phosphoribosyltransferase-like LOC100017413 __SEG__ Chr4 {Monodelphis domestica} MANRSPSIRIGDDAPGYDLDCFSIPKNYAQDLEKVFIPHGLIMDRIERLARDVLQDMGGQHIVALCVLKGAYKFFSDLLNAMETLNRNSDQASPITVDFIRVSSYCNDQS
TGSVRVLGGADLSSLAGKNVLIVEDIVDTGRTMQALLPLVEQHGPRMVRVASLLVKRTPRSLGYTPDFSGFEIPDRYVVGYAFDYNDYFRDLSHVCTLRETAKDKYALAV
QKL*
9 >lcl|XP_001371059.1|Plus1complement(7627513..7628184) NW_001581928 hypoxanthine-guanine phosphoribosyltransferase-like LOC100017526 __SEG__ Chr4 {Monodelphis domestica} MANRSPSIRIGDDAPGYDLDCFSIPKNYAQDLEKVFIPHGLIMDRIERLARDVLQDMGGQHIVALCVLKGAYKFFSDLLNAMETLNRNSDQASPITVDFIRVSSYCNDQS
TGSVRVLGGADLSSLAGKNVLIVEDIVDTGRTMQALLPLVEQHGPRMVRVASLLVKRTPRSLGYTPDFSGFEIPDRYVVGYAFDYNDYFRDLSHVCTLRETARDKYALAV
QKL*
10 >lcl|XP_001371153.1|Plus17706885..7707556 NW_001581928 hypoxanthine-guanine phosphoribosyltransferase-like LOC100017665 __SEG__ Chr4 {Monodelphis domestica} MANRSPSIRIGDDAPGYDLDCFSIAKNYAQDLEKVFIPHGLIMDRIERLARDLLQDMGGQHIVALCVLKGAYKFFSDLLNAMETLNRNSDQASPITVDFIRVSSYCNDQS
TGSVRVLGGADLSSLAGKNVLIVEDIVDTGRTMQALLPLVEQHGPRMVRVASLLVKRTPRSLGYTPDFSGFEIPDRYVVGYAFDYNNYFRDLSHVCTLRETAKDKYALAV
QKL*
11 >lcl|XP_001371231.1|Plus17733597..7734268 NW_001581928 hypoxanthine-guanine phosphoribosyltransferase-like LOC100017785 __SEG__ Chr4 {Monodelphis domestica} MANRSPSIRIGDDAPGYDLDCFSIPKNYAQDLEKVFIPHGLIMDRIERLARDVLQDMGGQHIVALCVLKGAYKFFSDLLNAMETLNRNSDQASPIMVDFIRVSSYCNDQS
TGSVRVLGGADLSSLAGKNVLIVEDIVDTGRTMQALLPLVEQHGPRMVRVASLLVKRTPRSLGYTPDFSGFEIPDRYVVGYAFDYNDYFRDLSHVCTLRETARDKYALAV
QKL*
12 >lcl|XP_001371444.1|Plus17866795..7867466 NW_001581928 hypoxanthine-guanine phosphoribosyltransferase-like LOC100018088 __SEG__ Chr4 {Monodelphis domestica} MANRSPSIRIGDDAPGYDLDCFSIPKNYAQDLEKVFIPHGLIMDRIERLARDVLQDMGGQHIVALCVLKGAYKFFSDLLNAMETLNRNSDQASPITVDFIRVSSYCNDQS
TGNVRVLGGADLSSLAGKNVLIVEDIVDTGRTMQALLPLVEQHGPRMVRVASLLVKRTPRSLGYTPDFSGFEIPDRYVVRYAFDYNDYFRDLSHVCTLRETARDKYALAV
QKL*
13 >lcl|XP_001374265.1|Plus1complement(25633148..25634020) NW_001581837 purine nucleoside phosphorylase-like LOC100022406 __SEG__ Chr1 {Monodelphis domestica} MENEYKYEDYKKTAEWLLSLTEHRPQIAVICGSGLGGLANKVTQLQAFDYSEIPNFPQSTVPGHEGRLVFGYLNDKCCVIMQGRFHMYEGYALSKVAFPVRVFQLMNVHT
LIVTNAAGGLNPEYEVGDIMLIRDHINLAGLSGQNPLRGPNDRRFGERFPPMSDAYDRILREKAHGIWKKMDQQRPLHEGTYVMVGGPSFETIAECRFLQKIGADAVGMS
TVPEVIVARHCGLRVFGFSLITNKSILDYETHETANHEEVLMAGQEAAKKLEEFVCILVKNIHPPSEKTF*
14 >lcl|XP_001378792.1|Plus110489168..10489764 NW_001581878 guanylate kinase-like LOC100028883 __SEG__ Chr2 {Monodelphis domestica} MTGPRPVVLSGPSGAGKSTLLKKLLQEYGNIFGFSVSHTTRNPRPGEENGKDYHFVTREEMQRDIDAGKFIEHAEFSGNMYGTSKAAVQAVQVMNRICVLDIDLQGVRNI
KKMELRPIYISIQAPSLDILEKRLRDRKTETEESLQKRLTAAVADMESSKEPNLFDLIIINDDLDEAYLMLRKVLAEEIKKAQQPNDL*
15 >lcl|XP_001381376.1|Plus111880962..11881834 NW_001581954 purine nucleoside phosphorylase-like LOC100032342 __SEG__ Chr4 {Monodelphis domestica} MENEYKYEDYKKTAEWLLSLTEHRPQIAVICGSGLGGLANKVTQLQAFDYSEIPNFPQSTVPGHEGRLVFGYLNDKCCVIMQGRFHMYEGYALSKVAFPVRVFQLMNVHT
LIVTNAAGGLNPEYEVGHIMLIRDHINLAGLSGQNPLRGPNDRRFGERFPPMSDAYDRILREKAHGIWKKMDQQRPLHEGTYVMVGGPSFETIAECRFLQKIGADAVGMS
TVPEVIVARHCGLRVFGFSLITNKSILDYETHETANHEEVLMAGQEAAKKLEEFVCILVKNIHPPSEKTF*
16 >lcl|XP_003341841.1|Plus1complement(41418639..41419511) NW_001581988 purine nucleoside phosphorylase-like LOC100618214 __SEG__ Chr7 {Monodelphis domestica} MENEYKYEDYKKTAEWLLSLTEHRPQIAVICGSGLGGLANKVTQLQAFDYSEIPNFPQSTVPGHEGRLVFGYLNDKCCVIMQGRFHMYEGYSLSKVAFPVRVFQLMNVHT
LIVTNAAGGLNPEYEVGDIMLIRDHINLAGLSGQNPLRGPNDRRFGERFPPMSDAYDRILREKAHGIWKKMDQQRPLHEGTYVMVGGPSFETIAECRFLQKIGADAVGMS
TVPEVIVARHCGLRVFGFSLITNKSILDYETHETANHEEVLMAGQEAAKKLEEFVCILVKNIHPPSEKTF*