SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab F    

ID / Description / Sequence
1 >lcl|XP_001496502.1|Plus1complement(24539073..24540029) NW_001867413 ribose-phosphate pyrophosphokinase 1-like LOC100053121 __SEG__ Chr4 {Equus caballus} MPNIKIFSGSSHQDLSQKIADRLGLELSKVMTKKFTNQETCVDIGESVHGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDENRAPISAK
LVANMLTIAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLRWIRENISEWRNCIIVAPDAGGAKRVTSIADRLNVDFALIHKERKKASKVDHMVLVGDVKDRVAILVD
DIADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAITRINSACLEAVVVTNTIPQEDKMKHCSKIQVIGIAMILAEAIRKTHNGESVSYLFSHVPL*
2 >lcl|XP_001917931.1|Plus1complement(19153539..19154075) NW_001867424 deoxycytidylate deaminase-like LOC100051296 __SEG__ Chr6 {Equus caballus} MSEVSWRKRDDYLQWPEYFMAVAFLSAQRSKDPNSQVAACIVNAENKIVGIGYNGMPNGCSDDLLPWRRTAENKLDTKYPYVCHAELNAIMNKNSADVKGCTMYVALFPC
NECAKLIIQTGIKEVIFMSDKYHDSDEATAARLLFDMAGVTFRKFTPKCSKIVIDFDSINSRPTQKPQ*