SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam F    

ID / Description / Sequence
1 >lcl|XP_003433000.1|Plus1complement(23323316..23323660) NW_876273 nucleoside diphosphate kinase, mitochondrial-like LOC100688193 __SEG__ Chr21 {Canis lupus familiaris} MGGFLERVALLGLLSGLQAPDPTLLTCPNSSGSSWTWEQTLVAVQPDGVQWRLAGDVIQRFERRDFKVVGMKTLQEHHPCSDSVEGAGERQLWLQSSEPVDWADKTHQSS
IHPT*
2 >lcl|XP_003433128.1|Plus12094357..2094920 NW_876274 nucleoside diphosphate kinase, mitochondrial-like LOC100685019 __SEG__ Chr22 {Canis lupus familiaris} MGGVLGRASLPGLLSGPWAPGPSLLAHPNSGGSSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFKLVGMKMLQAPERVLAEHHHDLQRKPFYPPLISYMTSGPVVAMV
WEGPSVVCSSRTMIGHTDSAEATPGTIRGDFSIHISRNIIHASDSVEGARREIQLWFQSSELVDWADKNHESSIYAA*
3 >lcl|XP_003435238.1|Plus1complement(<3271..4158) NW_876331 GTP:AMP phosphotransferase, mitochondrial-like LOC100684585 __SEG__ Chr9 {Canis lupus familiaris} MGASARLLRAVIMGAPGSGKGTVSSRITKHFALKHLSSGDLLRDNMLRGTEIGVLAKTFIDQGKLIPDGVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDGAYQIDT
VINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKAVGIDDLTGEPLIQRDDDKPETVVKRLKAYEVQTQPVLEYYRKKGVLETFSGTETNKIWPHVYAFLQTKVPQIN
QKASVTPLGKVYITSKMSRDSSPVHLEAPCSETGMYEFFENYISFTSTDFILEIKNGPNESDTKIHLFVYPGYLLW
4 >lcl|XP_003435384.1|Plus1complement(10084595..10085251) NW_876333 hypoxanthine-guanine phosphoribosyltransferase-like LOC100685506 __SEG__ Chr9 {Canis lupus familiaris} MASRSPSIVISDDEPGYDLDLFCIPNHYAQDLEKVFIPHGLIMDRTERLARDVMKEMGSHHIVALCVLKGGYTFFADLLDYIKALNRNSDRSIPMTVDFIRLKSNCSDQS
TGDIKVIGGDDLSTLTEKNVLIVEDLIDTGKTMQTLLSLVAQYNPKMVKVASLLVKRTPRSTGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA*
5 >lcl|XP_533309.2|Plus121193202..21194146 NW_876267 thymidylate synthase TYMS __SEG__ Chr19 {Canis lupus familiaris} MPAPGSELQRPPSPPAAQKPRARPQPPPHGELQYLGQVEHILSCGARKHDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSRGVKIW
DANGSRDFLDSLGFANREEGDLGPIYGFQWRHFGAEYKDKDSDYSGQGVDQLQKVIDTIKTNPDDRRIILCGWNPKDLPLMALPPCHALCQFYVVNGELSCQLYQRSGDM
GLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRRVEKIDDFKAEDFQIEGYNPHPTIKMEMAV*
6 >lcl|XP_537864.2|Plus126292896..26293672 NW_876284 GTP:AMP phosphotransferase, mitochondrial-like LOC480745 __SEG__ Chr27 {Canis lupus familiaris} MKSLSKFYQLARSPASAQPGRSPRAARLPAAKGASARLLRAVILGAPGSGKGTVSSRITKHFALKHLSSGDLLRDDMLRGTEIGVLAKTFIDQGKLIPDEVMTRLTLHEL
KNLTQYSWLLDGFPRTLPQAEALDGAYQTDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKAVGIDDLTGEPLIQRDDDQPETVVKRLKAYEVQTHPVLEYYRK
KGVLETFSGTETNKIWPHVYAFLQTKVPQINQKASVTP*
7 >lcl|XP_538558.1|Plus15141626..5142309 NW_876252 GTP:AMP phosphotransferase, mitochondrial-like LOC481438 __SEG__ Chr11 {Canis lupus familiaris} MGASVRLLRAVLMGPPGSGKRTVALRITKGFQLKTFSSGDLLRDNLLRDTEIGVLAKVFMDQGKLIPDDIMTRLTLHQLKTFTQESWLLCGFPRTLPQAEALERAYQIHL
VMSLNVPSEVIKQRLSARWIHPSSGRVYNLEFNPPKAIGLDDLTGEPLVQREDDRPETLNQRLKAYEDQTKPVLEYYREKGVLETFSGTKTDQIWPCVRAFLQTKVPQID
QKASVTP*
8 >lcl|XP_540202.3|Plus142248258..42249358 NW_876263 disks large homolog 3-like LOC483087 __SEG__ Chr17 {Canis lupus familiaris} MMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMMESNRSI
KTKRKKSFRLSRKFPFYKSKENMAQESSIQEQGVTSNTSDSESSSKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQ
DYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQVQLYPIAIFIKPKSIEAFMEMNRRQTYEQANKIYDKAMKLEQEFGEYF
TAIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL*
9 >lcl|XP_544812.3|Plus1complement(<7316934..7317884) NW_876295 ribose-phosphate pyrophosphokinase 1-like LOC487688 __SEG__ Chr31 {Canis lupus familiaris} MPNMKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGEGVRGEDVYIVQSGCGEISDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKEKSPAPISAK
LVADMLRVEGADRIITVDLQASQIQGFFDVPVDNLYAAPAVLQWIRESVSEWRDCTIVSPDAGGAKTVASIADRLNVHFAPVHRGRKKADEVDRVVLVGDVKDRVAILVD
DMADTCGTICLAADKLLSAGDSRVYAVLTHGILSGPAISRINSACFEAVVVTNTIPQEDKTKHCSKIQVIDISAILAEAIRRTHNGESVSCLFSHVP
10 >lcl|XP_852718.1|Plus1complement(36689155..36689613) NW_876327 nucleoside diphosphate kinase A-like LOC609873 __SEG__ Chr8 {Canis lupus familiaris} MANSERTFIAIKPDGVQRNLVGEIIKRLEQKGFCLIAMKLIQASEDLLKEHYIDLKDRPFFAGLVKYMQSGPVVATVWEGLNAVKTGRVMLGETNPGESKPGTIRGDFCI
QVGRNVIHGSDSVESAEKEIGLWFQPEELVDYKSCAQNWIYE*