SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau F    

ID / Description / Sequence
1 >lcl|NP_001071401.1|Plus1complement(137196..137348) NW_001494808 adenylate kinase 3-like 1 AK3L1 __SEG__ Chr3 {Bos taurus} MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKANTGER
2 >lcl|NP_001095953.1|Plus1complement(1887354..1888343) NW_001494872 phosphoribosyl pyrophosphate synthetase 1-like 1 PRPS1L1 __SEG__ Chr4 {Bos taurus} MDAKSLLQLTKKPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKLSNQETCVEIGESVQGEDVYIVQSGCGEINDNLMELLIMINACKIASAGRVTAVIPCFPYARQDK
RGESRAPISAKLVADMLSTAGADHIITMDLHASQIQGFFDIPVDNLCAEPAVLKWIKEQISDWRSCTIVSPDAGEVKRATSIADRLNVDFALIHKVRKKAGEVDGMVLVG
DVKYRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAVTRINSAGFEAVVVTNTVPQEDKMKHCSKIQVIDISMILAEAIRRIHSGKSVSYLFSHVPL*
3 >lcl|XP_001254560.1|Plus1complement(196292..197161) NW_001502709 Purine nucleoside phosphorylase-like NP __SEG__ Chr6 {Bos taurus} MENGFTYEDYQDTAKWLLSHTEQQPRVAMICGSGLGGLINRLTQAQTFDYSEIPNFPKSTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVEI
LVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNYETVAECRLLRNLGADAVGMS
TVPEVIVARHCGLRVFGFSLITNKVIMDYESQGKADHKEVLEAGKQAAQKLEQFVSLLMASIPLPGHTS*
4 >lcl|XP_002701458.1|Plus1<66268..67062 NW_001493362 protease-like LOC100297662 __SEG__ Chr15 {Bos taurus} KTTGKLIKGPSSSPTTKGRPNVMTLQAATSKSACTDIPSPYEVELIELYNPHKIPTGYYGPIPPRTMGLILGCNSCTMRGLMVLTGVTDEDYEGEIHIMVNVMKMGNVYL
QKREHFAQLLLLPYVKPMKVSDKVRQGGFGSTNLTAALSTLIKEHQKPMVTLRIQGKNFTGMLDTGANISIIRAAKWPLDWDKVIAPSRLLEVNEANATQTFVNASYLQM
YGPNQTVAYFKPYITNIPINLWGRDFLEQTKATISLNEPFSGGH*
5 >lcl|XP_002704047.1|Plus1complement(4569596..4570252) NW_001494824 hypoxanthine phosphoribosyltransferase 1-like LOC510369 __SEG__ Chr3 {Bos taurus} MATCSSSIVISDDEPGYDLDLFCIPNHYAEDLEKVFIPHGLIMDRTERLARDVMHVMGGHHIVALCVLKGGYKFFADLLDYIKVLNRNSDRSIPMTVDFIRLKSYYNDQS
TGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQALLSLVKRHNPKMVKVASLLVKRTPRSVSYRPDFVGFEIPDKFVVGYALDYNEHFRDLNHVCVISETGKAKYKA*
6 >lcl|XP_588793.1|Plus1complement(612905..613576) NW_001493651 adenylate kinase isoenzyme 4, mitochondrial-like AK3L1 __SEG__ Chr19 {Bos taurus} MASKLLRAVVLGPPGSGKGTVCQRIAQNFSLQHLSSGHFLRENIKANTEVGDMAKQYIEKGLLVPDHGITRLMLLELENRRGEHWLLDGFPRTLVQAEALDRLCDLDLVI
TLNIAFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGMDDVTGEPLVQQEDDKPEAVAARLRQYKDVARPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPVQSK
EAY*
7 >lcl|XP_869469.1|Plus1complement(83271..83906) NW_001492836 hypoxanthine phosphoribosyltransferase 1-like LOC613512 __SEG__ Chr10 {Bos taurus} MAAHSPSVVNSNDEPGYDLDLFCKTNHYAEDLQKVFVPHGLIMDRTERLARDVMKEMGGHHLVALCVLKGGYKFFADLNRNSDKSIPMTVDFIRLKSYCNDQSTGEIKVI
GGDDLSTLTEKNVLIVEDITDTGKTMQTLLSLVKKHKPKMVKAASLLVKRTPRSVRYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVITETRKAKYKA*
8 >lcl|XP_874583.1|Plus11660128..1660979 NW_001494248 CG4802-like LOC617264 __SEG__ Chr24 {Bos taurus} MSSGATPAAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALVLGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLKEEIQPGDIIII
DQFIDRTTRRLQTFYDGNHSCARGVCHIPMADPFCPKTREVLIETAKKLGLRCHSKGTVITIEGPRFSSREESIMFQTWGADVINMTTVPEVVLAKEAGICYESIAMATD
YDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSMEWSETLHNMKKMAQFSVLLPRH*