SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Sscr E    

ID / Description / Sequence
1 >lcl|NP_001090895.1|Plus1complement(205479..>206048) NW_001885764 D-aspartate oxidase DDO __SEG__ Chr1 {Sus scrofa} RVKGSGGLVLTRRVEDLWELHPSFNIVVNCSGLGSKQLVGDMEIFPVRGQVLKVQAPWVKHFIRDGSGLTYIYPGIANVTLGGTRQKGDWNLSPNAEISKQILSRCCALE
PSLRGACDIREKVGLRPSRPGVRLEKELLVQGSQRLPVVHNYGHGSGGIAMHWGTALEAARLVSECVQALRTPAPKSKL*
2 >lcl|XP_001928803.1|Plus1complement(160151..161395) NW_003533968 inactive serine protease 35-like LOC100156168 __SEG__ Chr1 {Sus scrofa} MEAMLFWWIFFTLGWTLIDGSEMEQDFMWHLRKIPRVVDERTFHLTSPTFEADAKMALNGVCGIECQKELPSPSLSDLEDSLSYETVFENGTRTLTRVKVQGWVPEPTQN
LTNQGVPIRRKRQVYGTDSRFSILDKRFLTNFPFNTAVKLSTGCSGVLISPNHVLTAAHCVHDGKDYIKGTRKLRVGLLKMRNKGGGKKRRRGSRRSRREVSGDDGGKES
KENLKESAKAGRRRNKSARGQRTAAGEPSFQWTRVKHTHIPKGWVRGESGDAALDYDYALLELKRSHKKKYMELGISPTIKKLPSGMIHFSGFDHDRADQLVYRFCSVSD
ESSDLLYQYCDAESGSTGSGVYLRLKEPGKKSWKRKIIAVYSGHQWVDVHGVEKDYNVAVRITPLKYAQICLWMHGDDANCTYG*
3 >lcl|XP_003123142.1|Plus1complement(466256..467341) NW_003534269 galactoside 3(4)-L-fucosyltransferase-like LOC100513844 __SEG__ Chr2 {Sus scrofa} MDPLDSAKIKCSWRHYLPWLFLQLLLALCFFSYLHVSQDAPTWAPEAKAPCQTTAAPSSRPPLLLLLWTWPFHVRVAVSRCSELRPGTADCQLTDNRGEYPRADAVLVHH
REVSSHPQRQLPPSPRPPGQRWVWFSMESPSHCPQLKALDGYFNLTMSYRRDSDIFMPYGWLEPWPGQPVDVQLNISAKNKLVAWVVSNWREDSVRVRYYRQLQAHLQVD
VYGRSHKPLPSSAMTTQLSQYKFYLAFENSLHTDYITEKLWRNALLAWAVPVVLGPSRRNYEQFLPPEAFIHINDFQSPKELAQYLLALDKDDARYLGYFRWRETLRPQF
FSWALMFCKACWRLQQEPSYQTVPSIASWFT*
4 >lcl|XP_003128096.1|Plus1complement(28656..29771) NW_003300207 4-hydroxyphenylpyruvate dioxygenase-like protein-like LOC100514057 __SEG__ Chr6 {Sus scrofa} MAAPVRRLCHVAFHVPAGQPLARDLQRFFGFRPLAVREADGWRQLALRSGDAVFLVNEGAGPGEPLYSLDPHHAVPGATNLCFDVADVGAAARALAALGCNVQVPPVTVQ
DAQGAATYAVVGSPAGNLSLTLLERPGFCGPFLPGFRPVSSVPGPGWVTHVDHLTLACPRSSSPKIMRWFHDCLGFHHLPLSPGEDPELGLEVAAGSGRGGLRLTALQAP
TGSAVPTLVLAESLPGSLRGRDQVEQFLAQNGGPGLQHVGLYTPNIMEATERVAGAGGQLLTPPEAYYQQPGKEKQILAAGHEPRLLARHGVLLDGDEGKFLLQVFTKSL
FAEDTFFLELIQRQGATGFGQGNIRALWQSVQEHAARVCEA*
5 >lcl|XP_003129779.1|Plus1complement(855508..856653) NW_003535513 serine protease 23-like isoform 1 LOC100520683 __SEG__ Chr9 {Sus scrofa} MLGMAGTPGLLFALLFLVLLCAVGQVSPYSAHWKPTWPAYRLPVVLPQSTFNLAKPDFGAEAKLEVSSSCGPQCHKGTPLPTYEEVKQYLSYETLYANGSRTETQVGIYV
LRSGEGEASGKSRRKRQIYGYDSRFSIFGKDFLLNYPFSTSVKLSTGCTGTLVAEKHVLTAAHCIHDGKTYVKGTQKLRVGFLKPKFKDGGRGANNSSSAVPEKMKFQWI
RVKRTHVPKGWIKGNANDIGMDYDYALLELKKPHKRKFMKIGVSPPAKQLPGGRIHFSGYDNDRPGNLVYRFCDVKDETYDLLYQQCDAQPGASGSGVYVRMWKRQQQKW
ERKIIGIFSGHQWVDMNGSPQDFNVAVRITPLKYAQICYWIKGNYLDCREG*
6 >lcl|XP_003130238.1|Plus1complement(5804695..5805651) NW_003535584 ribose-phosphate pyrophosphokinase 1-like LOC100515567 __SEG__ Chr9 {Sus scrofa} MPNIKIFSGSSHQDLSQKIAGRLGLKLGKVVTKKFSNQETCVEIGESVRGEDVYIMQSGCGEINDNLMELLIMINACKTASASRVTAVIPCFPYARQDKKDKNQAPISAK
LVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENISEWRNCTIVSPDADGAKRVTSIADRLNVDFALIHKEKKKANEVNRMVLVGDVKDRVAILVD
DIADTCGTICHAADKLLSAGAIRVYAILSHGIFSGPAITHINSACFEAVVVTNTIPQEDKMKRCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL*
7 >lcl|XP_003353312.1|Plus11348600..1349679 NW_003533943 alpha-(1,3)-fucosyltransferase-like LOC100155421 __SEG__ Chr1 {Sus scrofa} MTSASKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILIWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNRSHAVLIHH
RDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQ
AFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFW
ESHACLACDHVKRHQEYKSVGNLEKWFWN*
8 >lcl|XP_003357805.1|Plus114780..17011 NW_003535711 threonine synthase-like 1-like LOC100517488 __SEG__ Chr10 {Sus scrofa} MLHLNRCQHLKQITQRCFPSMHVKMDKHAQLFLSRPFALAELRKSWRSISSLMGDKNIVLMGPPGAGKTTVGRIIGQKLGCCVIDVDDDILEKTWNMSVSEKLQDVGNEQ
FLEEEGRAVLNLSASGSVISLTGSNPMHDGSMWHLKKNGIIVYLDVPLIDIVGRLKLMKIDRIVGQNSGTSMKDLLKFRRQYYKKWYDTRVFCESGASPEEVADKVLNAV
KRYQDVDSETFISTRHIWPKDCEQKVPTKFFSDAVIEGLASDGGLFVPEKEFPKLNWREWKSLVGATYIERAQILLEKCIHPADIPPAKLGEMIETAYGENFACSKIAPV
RHLSGNQFILELFHGPTGSFKDLSLQLMPHIFAHCIPPSCNYMILVATSGDTGSAVLNGFSRLNNNDKQRIAVATFFPENGVSEFQKAQIIGNQQENGWAVGVKSDFDFC
QTSIKRIFKDSDFTGFLTVEYGTVLSSANSINWGRLLPQVVYHASAYLDLVSQGFISFGSPVDVCIPTGNFGNILAAVYAKMMGIPIRKFICASNQNHVLTDFIKTGHYD
LRERKLAQTFSPAIDILKSSNLERHLHLMANKDGQLMTRLFNQLEEQHHFQIEKILVEKLQQDFAADWCSEGECLAAIHSTYNTSGYILDPHTAVAKVVADRMQDKTCPV
IVSSTAHYSKFAPTIMQALKIKEINQTSSSQVYLLSSYNALPPPHAALLERTKQPEKMEYQVCAADVSVLKSHVEKLVQNQFM*