SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Rnor E    

ID / Description / Sequence
1 >lcl|NP_001009694.1|Plus124633709..24634665 NW_047760 ribose-phosphate pyrophosphokinase I -like LOC314140 __SEG__ Chr6 {Rattus norvegicus} MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAK
LVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWKNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVD
DMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL*
2 >lcl|NP_001014090.1|Plus1complement(8554759..8555874) NW_047718 4-hydroxyphenylpyruvate dioxygenase-like Hpdl __SEG__ Chr5 {Rattus norvegicus} MAAPARRLCHIAFHVPAGQPLARDLQRIFGFQPLAVREAGGWRQLALRSGDAVFLVNEGTGPREPLYGLDPHHSVPSATNLCFDVEDVDRAARALAARGCIMPVPPTRVR
DAQGTATYTVVSSPAGNLSLTLLQRAGYRGSFLPGFRPLPCTPGPGWVSHVDHLTLACTSGSSPTLMRWFHNCLGFHHLPLSPGEDPELGLKVAVGSGRGGLRLTALQTL
PNSTVPTLVLAESLPGLTSEQDQVEQFLTRHGGPGLQHVGLYTPNIIDASEGMAKAGGRLLTPPEAYYQQPGKEEQILASGHKPSFLERQGILLDGDKDEFLLQVFTKSL
FDEDTFFLELIERQGATGFGQNNIRALWQSVQEEAARAQGT*
3 >lcl|NP_001020206.1|Plus1450267..452504 NW_047497 threonine synthase-like 1 Thnsl1 __SEG__ Chr17 {Rattus norvegicus} MLSFTRCHHLKRITQKCFSSALVKVQTPTQLSLPRALACAESGKSWHSTHSLVGDKNIVLMGPPGAGKTTVGRILGDKLGCCVIDVDADVLEKTWNMSVSEKLQDVGNER
FLEEEGKAVLNLFASGSVISLSGSNPMHDASMWHLKKNGIVVYLDVPLTDIISRLKSMRVDRIVGRNTGTSLRDLLKHGKLHYRKWYDARVFCESGASAEEVADKVLDVV
KRYQDVDSETFISTRHVCLKDHDKKFPPKYFSEAVVEGLASDGGLFVPEKGFPKLSLGEWTNLIGATYIERAQVLLERCIHPADIPAAKLGEMIETAYGESFACSKVAPV
RHLSGNQFILELFYGPTGSFKDLSLQLMPHIFAYCIPPGCNYVLLVATSGDTGSAVLNGFSRLNRSDKERIAVLTFFPENGVSDFQRAEIVGSQRENGWAIGVKSDFDFC
QAAIRKIFNDSDFTGFLTVEYGVVLSSANSINWARLLPQVVYHASAYLELVSQGFISFGSPVDVCIPTGNFGNILAAVYAKMMGIPIRKFICASNQNHVLTDFIKTGHYD
LRNRRLAQTFSPSINILKSSNLERHLYLMANKDGQLMADLYNQLESQLHFQIEELLVEKLQQDFVADWCSEGECLEAISTTYNTSGYILDPHTAVAKVVADKMQDKSCPV
VIASTAHYSKFAPVVLQALRIKELNQTSASQLYLLSSYNALPPPHEALLERMKQKGKMDYQACVADVDVLKSHVEKLIQSWFREV*
4 >lcl|NP_001036084.1|Plus1complement(1633210..1634022) NW_047627 3 beta-hydroxysteroid dehydrogenase/delta-5-delta-4 isomerase type II Hsd3b __SEG__ Chr2 {Rattus norvegicus} GTQNLLEAGIHASVPAFIYCSTVDVAGPNSYKKTILNGREEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGTLHTCALRPMYIYGERGQFLSRIIIMALKNKGVLN
VTGKFSIVNPVYVGNVAWAHILAARGLRDPKKSQNIQGQFYYISDDTPHQSYDDLNCTLSKEWGLRLDSSWSLPLPLLYWLAFLLETVSFLLRPFYNYRPPFNCHLVTLS
NSKFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ*
5 >lcl|NP_001096833.1|Plus19438232..9439419 NW_047558 hypothetical protein LOC100125384 LOC100125384 __SEG__ Chr1 {Rattus norvegicus} MLAAGSCSVRTILQPALLLGHSREVVCELVTSFRNFCSKYSVPPSPKYGGKHTVTMIPGDGIGPELMVHVKRIFRSNCVPVEFEEVWATSTSSEEEINNALMAIRRNRIT
LKGNIATNHHLPAKYKSHNTKFRTALDLYASVVHFKTFPGVETRHKDIDILVVRENTEGEYTNLEHESVRGVVESLKIVTKTKSVRIADYAFRLAQKMGRKKVTVVHKAN
IMKLGDGLFLQCCKDVAAHYPQITLESMIIDNTAMQLVSKPQQFDVMLMPNLYGNIINSVCTGLVGGSGIVPGANYGDSYAIFETGSKEIGQDLAHRNIANPVAMLLTSC
IMLDYLDLQLYAAHIRSAVMASLQNKSICTPDIGGQGTTAGVVEYILDHMKDQNSGCQPRFFLST*
6 >lcl|NP_001099148.1|Plus1593552..594508 NW_047760 phosphoribosyl pyrophosphate synthetase 1-like 1 Prps1l1 __SEG__ Chr6 {Rattus norvegicus} MPNIKIFSGSSHQDLSQKITERLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDSLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPMSAK
LIANMLSIAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENISDWRNCTIVSPDAGGAKRVTSIADHLNVDFALIHKERKKANEVDRMVLVGDVKERVAILVD
DMADTCGTICYAADKLLSEGATRVYAILTHGIFSGPAIARINGACFEAVVVTNTIPQEDKMKQCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL*
7 >lcl|NP_071555.2|Plus1complement(8227549..8228850) NW_047798 fucosyltransferase 4 Fut4 __SEG__ Chr8 {Rattus norvegicus} MAPAGRKLQHESRCRPSRPVDAWRAAATTRGRCMGTPGARRRARRGGWGLPRTSSGLAAAGLLCTALTACLCWGQLPPLPWASPAPQRPVSVLLWWEPFGGRGGHSKPPP
DCSLRFNISGCRLLTDRAAYGEAQAVLFHHRDLVKGPPDWPPPWGAQERTDEAPELRVFDDQEGAVMLAREALETTGSRPPGQRWVWMNFESPSHTPGLRGLAKDLFNWT
LSYRTDSDIFVPYGFLYPRSHPAEQPSGLGPPLARKRGLVAWVVSHWNERQARVRYYHQLRRHVSVDVFGRAGPGQPVPAVGLLHTVARYKFYLAFENSQHVDYITEKLW
RNAFLAGAVPVVLGPDRANYERFVPRGSFIHVDDFPSAASLAAYLLFLDRNVAVYRRYFHWRRSYAVHITSFWDEPWCQTCRAVQTSGDQPKSIHNLADWFQR*
8 >lcl|NP_445917.1|Plus1complement(15030082..15031161) NW_047711 alpha-(1,3)-fucosyltransferase Fut9 __SEG__ Chr5 {Rattus norvegicus} MTSTSKGILRPFLIVCIILGCFVACLLIYIKPTNSWVFSPMESASSVLKMKNFFSRKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHH
RDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTSPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQ
AFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDFNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFW
ESHACLACDHVKRHQEYKSVGNLEKWFWN*
9 >lcl|XP_002728314.1|Plus1complement(4162840..4163409) NW_047454 betaine--homocysteine S-methyltransferase 1-like LOC100363143 __SEG__ Chr15 {Rattus norvegicus} MEDSTSLQTIKLMKEGLEAARLKAYLMSQPLAYHTPDCGKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGILPPASEKH
GSWGSGLDMHTKPWIRARARKEYWQNLRIASGRPYNPLMSKPDAWGVTKGAAELMQQKEATTEQQLRALFEKQKFKSAQ*
10 >lcl|XP_002729275.1|Plus1complement(35089012..35090112) NW_047658 spermine synthase-like LOC683008 __SEG__ Chr3 {Rattus norvegicus} MAAARHSTLDFTLGAKADGEAILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDSDVQGKQETDSLLNKIEEKMKELSQDSTGRVKR
LPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGNGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVE
IDQMVIDGCKKYMRRTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEE
QLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP*
11 >lcl|XP_002729906.1|Plus16186429..6186764 NW_047784 hypothetical protein LOC100363067 __SEG__ Chr7 {Rattus norvegicus} MPVCCFTPAHGGTCEPPVTPHLGVYLESALKCAWQRDSGIIADPMVLRQRAMMKKMKRKEEEEEEEEEEGEEEEEEEEEEEEEEEEEEEEEEEEEEEEKEEEEEEEEEEE
E*