SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ptro E    

ID / Description / Sequence
1 >lcl|NP_001008978.1|Plus11128368..1129447 NW_003457153 alpha-(1,3)-fucosyltransferase FUT9 __SEG__ Chr6 {Pan troglodytes} MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHH
RDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQ
AFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFW
ESHACLACDHVKRHQEYKSVGNLEKWFWN*
2 >lcl|NP_001008985.2|Plus14475490..4477082 NW_003457704 alpha-(1,3)-fucosyltransferase FUT4 __SEG__ Chr11 {Pan troglodytes} MRRLWGAARKPSGAGWEKEWAEAPQEAPGAWSGRLGPGRSGRKGRAVPGWASWPAHLALAARPARHLGGAGQGPRPLDSGTAPFHSRASGERQRRLEPQLQHESRCRSST
PADAWRAEAALPVRAMGAPWGSPTAAAGGRRRWRRGRGLPWTVCVLAAAGLTCTALITYACWGQLPPLPWASPTPSRPVGVLLWWEPFAGRHSAPRPPPDCRLRFNISGC
RLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGVQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESPSHSPGLRSLASNLFNWTLSYRADSDVFVPY
GYLYPRSHPGDPPSGLAPPLSRKQGLVAWVVSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARYKFYLAFENSQHLDYITEKLWRNALLAGAVPVVL
GPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPAVYRRYFHWRRSYAVHITSFWDEPWCRVCQAVQRAGDRPKSIRNLASWFER*
3 >lcl|NP_001009004.1|Plus1105812..107488 NW_003459172 glutamate dehydrogenase 2, mitochondrial precursor GLUD2 __SEG__ ChrX {Pan troglodytes} MYRYLAKALLTSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAARRHYSELVADREDDPNFFKMVEGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIK
PCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTENELEKITRRFTMELAKKGFIGPGVD
VPAPDMNTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAV
GESDGSIWNPDGIDPKELEDFRLQHGSLLGFPKAKPYEGSILEIDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYF
EWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVNAIEKVFKVY
SEAGVTFT*
4 >lcl|NP_001009088.1|Plus1complement(1019172..1020296) NW_003458431 alpha-(1,3)-fucosyltransferase FUT5 __SEG__ Chr19 {Pan troglodytes} MDPLGPAKPQWLWRRCLAGLLFQLLVAVCFFSYLRVSRDDATGSPRPGLMAVEPVTGAPNGSRCQDSMATPAHPTLLILLWTWPFNTPVALPRCSEMVPGAADCNITADS
NVYPQADAVIVHHWDIMYNPSANLPPPTRPQGQRWIWFSMESPSNCRHLEALDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKLDSARV
RYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYL
SYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAWFT*
5 >lcl|NP_001009150.1|Plus1complement(987737..988816) NW_003458431 alpha-(1,3)-fucosyltransferase FUT6 __SEG__ Chr19 {Pan troglodytes} MDPLGPAKPQWSWRCCLTTLLFQLLVAVCFFSYLRVSRDDPTVYPNGSHFPDSTGTPAHSIPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHR
EVMYNPSAQLPRSPRRQGQRWIWFSMESPSNCRHLEALDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPVHPPLNLSAKTELAAWAVSNWGPNSARVRYYQSLQAHLKVDV
YGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRFF
SWALAFCKACWKLQEESRYQTRSIAAWFT*
6 >lcl|XP_001153854.2|Plus1complement(18734250..18735350) NW_003457175 spermine synthase-like isoform 2 SMS __SEG__ Chr7 {Pan troglodytes} MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGNFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKR
LPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVE
IDQMVIDGCKKYMRKTCGDVLDNLKGDCDQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEE
QLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP*
7 >lcl|XP_001160723.1|Plus18827257..8827778 NW_003457154 glycine cleavage system H protein, mitochondrial GCSH __SEG__ Chr6 {Pan troglodytes} MALRVVRSVRALLCTLRAVPSPAAPCPPRPWQLGVGAVRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAAS
ELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE*
8 >lcl|XP_001173892.1|Plus116987064..16987402 NW_003457668 isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial-like LOC749059 __SEG__ Chr11 {Pan troglodytes} MILVLKMLTVASGSVKAIFQPTILGYSWDILLGCEIPLRSFSFSHTIPPSAKCGGQHTVTMIPGDGTGAELMLPVKIMFRHVCVPVDFEGMSVTSTSASHEEEIHNAIMA
VH*
9 >lcl|XP_003308467.1|Plus12735664..2736548 NW_003456632 FAD synthase isoform 2 FLAD1 __SEG__ Chr1 {Pan troglodytes} MQPSSSAPPLHPYSTDGLIFPFNPQGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIGPTHDDVTFEAVAQAFGDELKPHPKLEAAT
KALGGEGWEKLSLVPSSARLHYGTDPCTGQPFRFPLVSVRNVYLFPGIPELLRRVLEGMKGLFQNPAVQFHSKELYVAADEASIAPILAEAQAHFGRRLGLGSYPDWGSN
YYQVKLTLDSEEEGPLEECLAYLTARLPQGSLVPYMPNAVEQASEAVYKLAESGRDLMEEVHYAQSHWWHPRSQ*
10 >lcl|XP_003312535.1|Plus15762918..5765149 NW_003457528 threonine synthase-like 1 isoform 1 THNSL1 __SEG__ Chr10 {Pan troglodytes} MLHFNRCHHLKKITQKCFSSIHVKTDKHAQRFLSRTFALAELRKSWYSTHSLVGDKNIILMGPPGAGKTTVGRIIGQKLGCCVIDVDDDILEKTWNMSVSEKLQDVGNEQ
FLEEEGKAVLNFSASGSVISLTGSNPMHDASMWHLKKNGIIVYLDVPLLDLIHRLKLMKTDRIVGQNSGTSMKDLLKFRRQYYKKWYDARVFCESGASPEEVADKVLNAI
KRYQDVDSETFISTRHVWPEECEQKVSAKFFSEAVIEGLASDGGLFVPAKEFPKLSCGEWKSLVGATYVERAQILLERCIHPADIPAARLGEMIETAYGENFACSKIAPV
RHLSGNQFILELFHGPTGSFKDLSLQLMPHIFAHCIPPSCNYMILVATSGDTGSAVLNGFSRLNKNDKQRIAVVAFFPENGVSDFQKAQIIGSQRENGWAVGVESDFDFC
QTAIKRIFNDSDFTGFLTVEYGTILSSANSINWGRLLPQVVYHASAYLDLVSQGFISFGSPVDVCIPTGNFGNILAAVYAKMMGIPIRKFICASNQNHVLTDFIKTGHYD
LRERKLAQTFSPSIDILKSSNLERHLHLMANKDGQLMTELFNRLESQHHFQIEKALVEKLQQDFVADWCSEGECLAAINSTYDTSGYILDPHTAVAKVVADRVQDKTCPV
IISSTAHYSKFAPAIMQALKIKEINETSSSQLYLLGSYNALPPLHEALLERTKQQEKMEYQVCAADMNVLKSHVEQLVQNQFI*
11 >lcl|XP_003316507.1|Plus1complement(2919102..2920316) NW_003458514 dapper homolog 3 isoform 2 DACT3 __SEG__ Chr19 {Pan troglodytes} MRSPRPCGRPPTDSPDVGGAGRPLDGYISALLRRRRRRGAGQPRTSPGGADGGPRRQNSVRQRPPDASPSPGSARPAREPSLERDSGHPTSPAALSRAPSSSWESEAAPE
PAFPPAAPSPPDSPAEGRLVKAQYIPGAQAATRGLPGRAARRKPPPLTRGRSVEQSPPRERPRAAGRRGRMAEASGRRGSPRARKASRSQSETSLLGRASAVPSGPPKYP
TAEREEPRPPRPRRGPAPTLAAQAAGSCRRWRSTAEIDAADGRRVRPRAPAARVPGPGPSPSAPQRRLLYGCAGSDSECSAGRLGPLGRRGPAGGVGGGYGESESSASEG
ESPAFSSASSDSDGSGGLVWPQQLVAATAASGGGAGAGAPAGPAKVFVKIKASHALKKKILRFRSGSLKVMTTV*
12 >lcl|XP_003317974.1|Plus1complement(5736..5897) NW_003469224 alpha-(1,3)-fucosyltransferase-like LOC100609596 __SEG__ Chr9 {Pan troglodytes} MNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA*
13 >lcl|XP_003318119.1|Plus1complement(708..1268) NW_003474761 putative L-type amino acid transporter 1-like protein MLAS-like LOC742193 __SEG__ Chr16 {Pan troglodytes} MAGAGPKRRALAAPVAEEKEEAREKIMAAKRADGAAPAGEGEGVTLQRNITLLKGVAIIVGAIMGSGIFVTPTGGLKEAGSPGLAPVVWAACGVFSIVGALCYAELGTTI
SKSGGDYAYMLDVCGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPLFPTCLVPEEAAKLVACHCVREYGARAG
14 >lcl|XP_003318127.1|Plus17345..8010 NW_003474860 putative L-type amino acid transporter 1-like protein MLAS-like LOC453981 __SEG__ Chr16 {Pan troglodytes} MAGAGPKRRALAAPVAEEKEEAREKIMAAKRADGAAPAGEGEGVTLQRNITLLNGVAIIVGAIIGSGIFVTPTGVLKEAGSPGLAPVVWAACGVFSIVGALCYAELGTTI
SKSGGDYAYMLDVYGSLPAFLKLWIELLVIRPSSQYIVALVFATYLLKPLFPTCPVPEEAAKLVACHCVREYGARAGGWEVVVPGSLHPCVTTPLAPTSLHFCVPGPSRQ
F*
15 >lcl|XP_524567.1|Plus1658615..659730 NW_003456527 4-hydroxyphenylpyruvate dioxygenase-like HPDL __SEG__ Chr1 {Pan troglodytes} MAAPALRLCHIAFHVPAGQPLARDLQRLFGFQPLASREVDGWRQLALRSGDAVFLVNEGAGSGEPLYGLDPRHAVPSATNLCFDVADAGAATRELAALGCSVPVPPVRVR
DAQGAATYAVVSSPAGILSLTLLERAGYRGPFLPGFRPVSSAPGPGWVSRVDHLTLACTPGSSPTLLRWFHDCLGFCHLPLSPGEDPELGLEMTAGFGLGGLRLTALQAQ
PGSIVPTLVLAESLPGATTRQDQVEQFLARHKGPGLQHVGLYTPNIVEATEGVATAGGQFLAPPGAYYQQPGKERQIRAAGHEPHLLARQGILLDGDKGKFLLQVFTKSL
FTEDTFFLELIQRQGATGFGQGNIRALWQSVQEQSARSQEA*
16 >lcl|XP_528013.1|Plus1complement(14787072..14788028) NW_003457175 ribose-phosphate pyrophosphokinase 3 PRPS1L1 __SEG__ Chr7 {Pan troglodytes} MPNIKIFSGNSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIDESVRGEDVYIVQSGCGEINDSLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAK
LVANMLSIAGADHIITMDLHASQIQGFFDIPVDNLYAEPTVLRWIRENISEWKNCIIVSPDAGGAKRVTSIADQLNVDFALIHKEQKKANEVDCMVLVGDVNDRVAILVD
DMADTCGTICLAADKLLSAGATRVYAILTHGIFSGPAISRINTACFEAVVVTNTIPQDDNMKHCSKIRVIDISMILAEAIRRTHNGESVSYLFSHVPL*