SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mmus E    

ID / Description / Sequence
1 >lcl|NP_001001297.1|Plus118134627..18135307 NT_039202 threonine synthase-like 1 isoform b Thnsl1 __SEG__ Chr2 {Mus musculus} MMGIPIRKFICASNQNHVLTDFIKTGHYDLRNRKLAQTFSPSIDILKSSNLERHLYLMANKDGQLMANLYHQLESQLHFRIEKMLVEKLQQEFVADWCSEGECLAAISTT
YNASGYILDPHTAVAKVVADKMQDKSCPVLIASTAHYSKFAPAIMQALGIKELNQTSSSQLYLLSSYNALPPPHEALLERMKQKEKMDYQVCVADVDVLKSHAEKLIQNW
FVRKSE*
2 >lcl|NP_001032835.2|Plus115664627..15665583 NT_039551 hypothetical protein LOC328099 Gm5081 __SEG__ Chr12 {Mus musculus} MSNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAK
LVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVD
DMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL*
3 >lcl|NP_034372.1|Plus1complement(1337616..1338917) NT_039472 alpha-(1,3)-fucosyltransferase Fut4 __SEG__ Chr9 {Mus musculus} MAPARQELQHESRCRPSRTVDAWRAAVATRGRHMETPGYRRRTRCGGWGLPRSVSSLAAVGLLCTALTTFICWGQLPPLPWASPAPQRLVGVLLWWEPFRGRGGYPKSPP
DCSLRFNISGCRLLTDRAAYGEAQAVLFHHRDLVKELHDWPPPWGARERTDKALVLRVFDDQEGAVTLTGKALETVGSRPPGQRWVWMNFESPSHTPGLRGLAKDLFNWT
LSYRTDSDVFVPYGFLYSRSDPTEQPSGLGPQLARKRGLVAWVVSNWNEHQARVRYYHQLSRHVSVDVFGRTGPGRPVPAIGLLHTVARYKFYLAFENSRHVDYITEKLW
RNAFLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPNAASLAAYLLFLDRNVAVYRRYFRWRRSFAVHITSFWDEQWCRTCQAVQTSGDQPKSIHNLADWFQR*
4 >lcl|NP_034373.1|Plus1complement(22546880..22547959) NT_039258 alpha-(1,3)-fucosyltransferase Fut9 __SEG__ Chr4 {Mus musculus} MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWVFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHH
RDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQ
AFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDFNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFW
ESHACLACDHVKRHQEYKSVGNLEKWFWN*
5 >lcl|NP_080000.1|Plus139487498..39488709 NT_039500 hypothetical protein LOC66716 4921510H08Rik __SEG__ Chr10 {Mus musculus} MTQTVNEREDPLNLGGGGWASSIPLRTWSSYHRRQRGAPVSKRRYRDGPKIEYEASRKQPKQQRSPGSWFQPSRGPYWALYSNWERCGGPWRPPLIAFQSPLCPAQMIRA
YGLHPLCVCCCSCWSGPWNPGWERPPGRKKRWGRRGRGLRRHPRRSFPRNPPIDLSKMLRPVNLSGWRAPGMRAPRNTTQFIMNQVYEDMRQQEKLERQQAALRAQQAQE
GGISPGDSTTNDAPHSGVEEDSQLPEDLYGFMQDPSLTFSPALMQHNQSPTPGLVEEEEKNVDDDECDVEVCDEKEESEEEEEEEVDRGSEDEDVDEEEVEAAGNGEEGE
EDQEEEYMLEETGLEEGEQRAEEKFLPLGMPLSILVGDEEERENFMNYDYLSQEQIIPNVPEADLFMVPDISH*
6 >lcl|NP_083570.1|Plus132669560..32670516 NT_039548 phosphoribosyl pyrophosphate synthetase 1-like 1 Prps1l1 __SEG__ Chr12 {Mus musculus} MPNIKLFSGSSHQDLSQKITERLGLELSKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDSLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAK
LVANMLSIAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENISDWRNCTIVSPDAGGAKRVTSIADHLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVD
DMADTCGTICYAADKLLSEGATRVYAILTHGIFSGPAIARINGACFEAVVVTNTIPQEDKMKQCSKIQVIDIAMILAEAIRRTHNGESVSYLFSHVPL*
7 >lcl|NP_666368.1|Plus1complement(16943951..16945066) NT_039264 4-hydroxyphenylpyruvate dioxygenase-like protein Hpdl __SEG__ Chr4 {Mus musculus} MTAPARRLCHIAFHVPAGQPLARDLHRVFGFQPLAVREAGGWRQLALRSGDAVFLVNEGTGPQEPLYSLDPHHSVPSATNLCFDVEDVDGAARALAARGCIMPVPPTRVR
DAQGTATYTVLSSPAGNLSLTLLQRAGYRGSFLPGFRPLPCTPGPGWVSHVDHLTLACTSGSSPMLMRWFHDCLGFHHLPLSPGEDPEMGLKVAAGSGRGGLRLTALQTP
PNNTVPTLVLAESLPGLNSKQDQVEQFLTRHGGPGLQHVGLYTPNIIDASEGMAKAGCRLLTPPEAYYQQPGKEEQILAAGHKPGLLERQGILLDGDKDEFLLQVFTKSL
FAEDTFFLELIQRQGATGFGQNNIRALWQSVQEEAARAQGA*
8 >lcl|NP_766489.1|Plus111498396..11499586 NT_039424 RIKEN cDNA 4933405O20 4933405O20Rik __SEG__ Chr7 {Mus musculus} MLAVTSCSMKTVLQYAVFLGHSREVVCELVTSFRSFCSHCAVPPSPKYGGRHTVAMIPGDGIGPELMVHVKKIFRSNCVPVDFEEVWVTSTSNEEEINNALMAIRRNRVA
LKGNIATNHNLPARYKSHNTKFRTILDLYASVVHFKTFPGVMTRHKDIDILVVRENTEGEYTNLEHESVKGVVESLKIVTKTKSVRIADYAFKLAQKMGRKKVTVVHKAN
IMKLGDGLFLQCCKDVAAHYPQITLESMIIDNTTMQLVSKPQQFDVMVMPNLYGNIINSICTGLVGGSGIVPGANYGDSYAIFEMGSKEIGKDLAHRNIANPVAMLLTSC
IMLDYLDLQPYATHIRSAVMASLQNKAVCTPDIGGQGNTASTVEYILHHMKEQTSGCHPNFFLQFT*
9 >lcl|NP_780388.2|Plus1complement(40204558..40207956) NT_039706 protein Fam123b Fam123b __SEG__ ChrX {Mus musculus} MESQQDEAVQTKGASTSSDAQDQGAEKGAKNKTTEATEGPTSEPPLSGPGRLKKTAMKLFGGKKGICTLPSFFGGGRSKGSGKVSSKKSLNKSKTHDGLSEASQGPEDVV
IEETDLSTPLSKSSAQFPSSQSANGALEIGSKHKTSGTEAIEKAGVEKVPSVHKPKKSLKSFFSSIRRHRKGKTSGADQSVPGAKELEGARTRSHEHVSSISLPSSEEIF
RDTRKENAKPQDAPGPKMSPAQVHFSPTTEKAACKNPEKLTRTCASEFMQPKPVLEGGSLEEPHTSETEGKVVAGEVNPPNGPVGDQLSLLFGDVTSLKSFDSLTGCGDI
IAEQDMDSMTDSMASGGQRANRDGTKRSSCLVTYQGGGEEMALPDDDDNDDEEEEEEEEEEEEEEEEEEEEEEEEEEEELLEDEEEVKDGEENDDLEYLWASAQIYPRFN
MNLGYHTAISPSHQGYMLLDPVQSYPNLGLGELLTPQSDQQESAPNSDEGYYDSTTPGFEDDSGEALGLAHRDCLPRDSYSGDALYEFYEPDDSLEHSPPGDDCLYDLRG
RNSEMLDPFLNLEPFSSRPPGAMETEEERLVTIQKQLLYWELRREQREAQEACAREAHAREAYARDTHTRESYGRNVRARETQALEAHSQEGRVQETKVRQEKPALEYQM
RPLGPSVMGLVAGTSGGSQTSHRGTTSAFPATSSSEPDWRDFRPLEKRFEGTCSKKDQSTCLMQLFQSDAMFEPDMQEANFGGSPRKAYPSYSPPEEPEEEEEEKEGNAT
VSFSQALVEFTSNGNLFTSMSYSSDSDSSFTQNLPELPPMVTFDIADVERDGEGKCEENPEFNNDEDLTASLEAFELGYYHKHAFNSYHSRFYQGLPWGVSSLPRYLGLP
GVHPRPPPAAMALNRRSRSLDNAESLELELSSSHLAQGYMESDELQAHQEDSDEEGEEEEGEWGRDSPLSLYTEPPGVYDWPPWAHCPLPVGPGLAWMSPNQLYEPFNQS
SYVQATCCVPPVAMPVSVPGRTPGDSVSQLARPSHLPLPMGPCYNLQSQASQSGRAKPRDVLLPVDEPSCSSISGANSQSQAKPVGITHGIPQLPRVRPEPFQLQPNHYR
ASNLDLSKERGEQGASLSTSYSSTAMNGNLAK*
10 >lcl|NP_780700.1|Plus126096408..26098765 NT_096135 Smith-Magenis syndrome chromosomal region candidate gene 8 protein homolog isoform 2 Smcr8 __SEG__ Chr11 {Mus musculus} MISAPDVVAFTKEDEYEEEPYNEPALPEEYSVPLFPYASQGANPWSKLSGAKFSRDFILISEFSEQVGPQPLLTIPNDTKVFGTFDLNYFSLRIMSVDYQASFVGHPPGS
AYPKLNFVEDSKVVLGDSKEGAFAYVHHLTLYDLEARGFVRPFCMAYISADQHKIMQQFQELSAEFSKASECLKMGNRKAFAGELEKKLKDLDYTRTVLHTETEIQKKAN
DKGFYSSQAIEKANELANVEKSIIEHQDLLRQIRSYPRQKTKIPDLQPGDTEHTQDQADQVSTTSNPEESANADLYTCRPAYTPKLIKAKSTKCFDKKLKTLEELCDTEY
FTQTLAQLSHIEHMFRGDLCYLLTSQIDRVLRKQQPITNFLFEDFVEVDDRMEKQENVPSQPSQDRLPPKPVEECPIPKVLISVGSYKSSVESVLIKMEQELGDEEYTGV
EATEARSFDPQENLDYLDMDMKGSISSGESIEVLGTEKSASVLSKSDSQASLTVPLSPHVVRSKAVSHRTISEDSIEVLSTCPSEALIPDDFKASYPSAINEEEAYADNE
GAIHFQASAGSPEPDETQEGNLENIPSQIDSSCCIGKESEGHLVPLPTPAYTLSDEDSVVSIPPQRYIQKDQGLHVDFGVENTDPSPRDNSCEMFPAYELDPSCLLASRD
VSKMSLDNYSDTTSYMGSAASTSSDRIPSAPPAGLSSERHKKRAGQNALKFIRQYPFAHPAIYSLLSGRTLVVLGEDETIVRKLVTALSIFVPNYGCYAKPVKHWISSPL
HIMDFQKWKLIGLQR*
11 >lcl|NP_808256.1|Plus118133064..18135307 NT_039202 threonine synthase-like 1 isoform a Thnsl1 __SEG__ Chr2 {Mus musculus} MLTLTRCHHLKQIAQECLSSLLVKVQSRTQLLLPRASARAESGKSWHSTHSLVGDKNIVLMGPPGSGKTTVGRILGDKLGCCVIDVDSDVLEKAWNMSASEKLQDVGNER
FLEEEGKTVLNLSASGSVISLSGSNPMHDASMWHLKKNGIVVYLDVPLTDIISRLKSMRIDRIVGQNTGASLRDSLKHVRLYYKKWYDARVFCESGASAEEVADKVLDVV
KRYQDVDSETFISTRHVCLKDHDKKFPPKYFSEAVVEGLASDGGLFVPEKEFPKLSPGEWNNLIGATYIERAQVLLERCIHPADIPAAKLGEMIETAYGENFACSKVAPV
RHLSGNQFILELFYGPTGSFKDLSLQLMPHIFAYCIPPGCNYVILVATSGDTGSAVLNGFSHLNKNDKERIAVVTFFPENGVSDFQKAEIIGSQRENGWAIGVRSDFDFC
QTAIRKIFNDSDFTGFLAVEYGTILSSANSINWARLLPQIVYHASAYLELVNQRFISFGSPVDVCVPTGNFGNVLAAVYAKMMGIPIRKFICASNQNHVLTDFIKTGHYD
LRNRKLAQTFSPSIDILKSSNLERHLYLMANKDGQLMANLYHQLESQLHFRIEKMLVEKLQQEFVADWCSEGECLAAISTTYNASGYILDPHTAVAKVVADKMQDKSCPV
LIASTAHYSKFAPAIMQALGIKELNQTSSSQLYLLSSYNALPPPHEALLERMKQKEKMDYQVCVADVDVLKSHAEKLIQNWFVRKSE*
12 >lcl|NP_848853.2|Plus16320181..6321410 NT_039476 inactive serine protease 35 precursor Prss35 __SEG__ Chr9 {Mus musculus} MENTLLWLVILIPGWALSDGSETELDFTWHLSRIPQVVSENTIHLASPTFQADAGVVKATVCGIECQEELPAPSLSQLEESLSYETIFENGTRTLTRVKVQGLVLEPTRN
SSVKGAHPRRRRQVYGTDSRFSILDKRFATNFPFNTAVKLSTGCSGTLVSPNHVLTAAHCVHDGKDYVKGSKKLRVGVLKMRNKGGRKKRRGSKRSRREAESAGQSQAHL
RESTTQRPGKKSRRGPRVTQGRPSFQWTRVKSTHIPKGWVRGENGGLALDYDYALLELKRAHKQQHMELGVSPTITKLPGGRIHFSGFDNDRDEQLVYRFCSVSEESNDL
LYQYCDAEAGSTGSGIYLRLKEPGQKNWKRKIVAVYSGHQWVDVHGVQKDYNVAVRITPLKYAQICLWIHGNAANCAYG*
13 >lcl|XP_001473484.1|Plus1complement(7612867..7613967) NT_039706 spermine synthase-like Gm14680 __SEG__ ChrX {Mus musculus} MAAARHSTLDFKLGAKADGEAILKGLQSIFQEQGMTESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDSDVQGKQETDSLLNKIEEKMKELSQDSTGRVKR
LPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVE
IDQMVIDGCKKYMRRTCGDVLDNLRGDCYQVLIEDCIPVLKMYAKEGREFDYVINDLTAVPISTSPEEDSTWDFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEE
QLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP*
14 >lcl|XP_003085391.1|Plus1complement(5882235..5882570) NT_078380 hypothetical protein LOC100504173 LOC100504173 __SEG__ Chr3 {Mus musculus} MSDAAVHTSSEITTKDLNEKKEVVEEAENGRDAPANVNAQNEANREQEADNEVDEEEEEGGEEEEEEEEGEGEEEDGDEDEEAEAPVGKPVAEDDEDDDVDTKKHKTEED
D*