SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Mdom E    

ID / Description / Sequence
1 >lcl|XP_001362614.1|Plus11633091..1634476 NW_001581911 ornithine decarboxylase-like LOC100011888 __SEG__ Chr3 {Monodelphis domestica} MNSFSNDEFDFNFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWYKALPRVTPFYAVKCNDSRAILKTLAAVGAGFDCASKTEIQLVQSLGVPPGRIIY
ANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLSIATDDSKAVCRLSVKFGATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFD
MGAEFGFNMYLLDIGGGFPGSEDVKLKFEEISSVINPALDKYFPPDSGVRIIAEPGRYYVASAFTLAVNIIAKKLVLKEQTGSDDEDEANDQTFMYYVNDGVYGSFNCIL
FDHAHVKPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQCMQQIKNQGFPAEVEDQDINTLPLS
CAWESGMEHHSTTCTSASVNV*
2 >lcl|XP_001363706.1|Plus14901547..4902503 NW_001581963 ribose-phosphate pyrophosphokinase 2-like LOC100012872 __SEG__ Chr4 {Monodelphis domestica} MPNILLFSGNSHQDLSQKVADRLGLKLGKVVSTKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLLMINACKIASSSRVTAVIPCFPYARQDKKDKSRVPISAK
LVANMLSVAGADHIITMDLHASQIQGFFDIPVDNMYAEPAFLQWIQKNITEWRNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKNRVAILVD
DIADTCGTICHAADKLLSAGATKIYAIVTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMDRCSKIQVIDISMILAETIRRTHNGESVSYLFSQVPL*
3 >lcl|XP_001367612.1|Plus170779935..70781014 NW_001581879 alpha-(1,3)-fucosyltransferase FUT9 __SEG__ Chr2 {Monodelphis domestica} MTSTSKGIFRPFLITCIILGCFMACLLIYIKPTNSWIFGPIETSSSVLKMKNFFSSKTDDLNETIILIWVWPFGQTFDLSSCQPMFNIHGCHLTTDRALYNKSHAVLIHH
RDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGSMKVSTNSLVFEVPSKKKLVCWVVSNWNPEHARVKYYSELSKSIEINTYGQ
AFGEYLNDKNLIPTISSCKFYLSFENSIHKDYITEKLYNALLAGTVPVVLGPSRENYENFIPGDSFIHVEDYSSASELAKYLKELDRNDKLYLSYFNWRKTFTVNLPRFW
ETHACLACDHVKRHQEYKSVGNLEKWFWN*
4 >lcl|XP_001368099.1|Plus1complement(3131092..3132507) NW_001581963 alpha-(1,3)-fucosyltransferase-like LOC100013730 __SEG__ Chr4 {Monodelphis domestica} MARGTHLPQAWSPGGGEPGVWHSESGRCPLPPQASQQEDELPRRARRRGELQQYESRYLSPLRVGLGRATAAAAPAYPPLPMFMRWLGQLRGRSGGREMPRIVWLLLAVG
LLFSGLVFYIYLGLLPPLPWASSRPLVSPHQVTVLMWWEPFSGSGRSSGPAPDCQRQFNVSGCRLITDRKYYWEAQAVLFHHRDLVGTQDWPPPRPEPNGIAARVVGISW
MGSQPARPPGQRWVWMNFESPTNSPKLGSFDSSLFNWTLTYRADSDIFVPYGYLYPRNSLHDPPAGLMPPMSRKQGLVAWVISHWNEKQARVRYYYELRRHVKVDVFGLR
GPGRLMPDIGLLHTVARYKFYLAFENSQHQDYITEKLWRNSLLAGAVPVVLGPSRANYERFVPRSAFIHVDDFPNASALAAYLHFLDRNLNMYKRYFDWRRRYAVHTLSF
WDEPWCRTCQVLQIAGDRPKKMYNLAAWFQR*
5 >lcl|XP_001374334.1|Plus1complement(4821808..4822854) NW_001581841 alpha-(1,3)-fucosyltransferase-like LOC100022510 __SEG__ Chr1 {Monodelphis domestica} MSAYRLLFSHQAMVGMVLLIALWLLIAHFLSSSRPWDTGIWSLSGVLQPHSKLTVLIWHWPFNKSLPLDGDVCARYGVADCWLSTNRSLLHRANVVVFHHHELQSGAVRL
PLAKRPPGQPWVWTNLESPSNTHGLSRYRNIFTWVMSYRRDSDIFVPYGELVPRAGPDLPVPAKNRTAAWVISNYRRTQKRALVYSQLSKYLLIDVFGRASRKPLCAGCL
LPTLAPYRFYLAFENSQHPDYITEKLWRNALSAGVVPVVLGPPRATYEAFLPADSFVHVDDFGSVRDLATFLKSVNASHYQRFFAWRKRLAVRLYSDWRERFCGVCARYP
HLPQGQVYRDLEAWFKSQ*
6 >lcl|XP_001376199.1|Plus1complement(43493795..43496029) NW_001582021 threonine synthase-like 1-like LOC100025171 __SEG__ Chr8 {Monodelphis domestica} MLHISRCHHLKLITKTCSSFMHFKANRHLKLILPRTFTFRELKKSWFSTHSLLGDRNILLMGLPGAGKTTVGKIIGQKLACGVIDVDDDILETTWNMTVAEKLREVGHEQ
FLEEEGKVLLNFVASGAVISLSGSNPLHDATMYYLKKNGIVVYLDVPVIDIINRLNLTKIDRIVGPNSGMPLKEVLQYRRQLYKKWYDIRIFCEDGASAEVIADKVFNAI
KRYEDVDSETFVSTRYKPKGSEEKVFSKHFSEAVIEGLASDGGLFVPRKEFPKLNFVEWKSLVGATYIERAQLILERCIHPVDIPASRLGEMIETAYGENFTCSKIAPVR
HLWGNQFILELFHGPTGSFKDLSLQLLPHLFAYCIPPTCNYLVLVATSGDTGSAVLNGFSRLPSNDKQRIGAVTFFPENGISDFQKEQIIGNQRENGWAVGVKSDFDFCQ
TALRKMFNDSDFTGFLTIEYGTTLSSANSINWGRLLPQIIYHASAYLDLVSQGSISFGSPVDVCIPTGNFGNILAAVYAKMMGIPIRKFICASNKNHVLTDFIKTGLYDL
RKRKLVQTFSPSLDILKSSNLERHLHFVTDRDGKLMSKLFHQLENQQHFQLEKILVEKLQQDFVADWCSEENCLAAINSTYHTSGYILDPHTAVAKVVADKVQDKTCPVI
LASTAHYSKFASAIMQALKIQEINQTSSGQLSLLSSYNALPPPHEGLLGRIKQQGSEYQVCAPDVNVMKEHLETLIQKHFMKVS*
7 >lcl|XP_001380475.1|Plus15071925..5072704 NW_001581924 solute carrier family 35 member E4-like LOC100031148 __SEG__ Chr3 {Monodelphis domestica} MSSTHGAPAATLLLPWRRAPRAQGQGEGQWPAAGSPGRVLATVLVWLATGTGMSSLNKWLFAVHGFRYPLLLSALHMLTAVLLGYPLAGHRAHRPLPARAKRRLFLLSLT
FCAAVACGNLGLTYVHLDFAQMVYTTTPLFTLALSKAILGRRHHPLQYAAMGPICLGAACSILGEMHFHRTGCCFLFAATFLRGLKSVQQSEYPLPAVLGTLLPHKCQSS
LQLWDLRGLSLTGVPRPLLALAPPVLGSSSPGTPCSRLL*
8 >lcl|XP_003342080.1|Plus19387605..9388750 NW_001582020 isocitrate dehydrogenase [NAD] subunit beta, mitochondrial-like LOC100011355 __SEG__ Chr8 {Monodelphis domestica} MAALGSVRVISQSLVVGRRPGAWRGLITTAATHSAQPKHGVGDEKEGKVIPVTMVPGDGVGPELMEAVRKVFKAALVPVEFQEYHLSGMENMATEEKLEQVLNSIRKNKI
AIIGKIHTPMDNNKGILSYNMQIKRKLDLFANVVPVQSLLGYETRHNNLDLVIIREQTEGEYSALEHESVKGVIECLKIITSYKSRRIAKFAFDYATKKGRKKVTAVHKA
NIMKLADGLFLKCCEEVAELYPKIKFENIIIDNCCLQLVKNPYQFDVLVMPSLYGNIVDNLAAGLVGGAGVVPGESYSGEYAVFETGAKHQYSQAAGKNIANPTAMLLSS
SNMLNYLNLKDHSSKIAGAVKAVIKTGKIRTEDMGGKNTTSEFIDSIIKHL*