SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Ecab E    

ID / Description / Sequence
1 >lcl|XP_001489945.1|Plus1complement(10806676..10807809) NW_001867427 serine protease 23-like LOC100060937 __SEG__ Chr7 {Equus caballus} MAGIPGLFLFLLLLLICAVGQGRPYGAHWKPTWPTYRLPVVLPQSTLSLAKPDFEAEAKLEVSSSCGPQCHKGTPLPTYEEVKQYLSYETLYANGSRTETQVGIYVLSSG
RGESSGKSRRKRQIYGYDSRFSIFGKDFLLNYPFSTSVKLSTGCTGTLVAEKHVLTAAHCIHDGKTYVKGTQKLRVGFLKPKFKDGGRRANDSSSAVPEKMKFQWIRVKR
THVPKGWIKGNANDIGMDYDYALLELKKPHKRKFMKIGVSPPSKQLPGGRIHFSGYDNDRPGNLVYRFCDVKDETYDLLYQQCDAQPGASGSGVYVRMWKRQQQKWERKI
IGIFSGHQWVDVNGSPQDFNVAVRITPLKYAQICYWIKGNYLDCREG*
2 >lcl|XP_001495539.1|Plus1complement(11627818..11630049) NW_001867401 threonine synthase-like 1 THNSL1 __SEG__ Chr29 {Equus caballus} MLHFKRCQHLKQITQKCFSSIHVKTDKHAQLFLSRTFALAELRKSWHSTHSLVGDKNIILMGPPGAGKTTVGRIIGQKLGCCVIDVDDDILEKTWNMSVSEKLQDVGNEQ
FLEEEGKAVLNFSASGSVISLTGSNPMHDASMWHLKKNGIIVYLDVPLIDIVSRLKLMKIDRVVGQNSGTSMKDLLKFRKQYYKKWYDTRVFCESGASPEEIADKVLNAV
KRYQDVDSETFISTRHIWPKDCEQKVSTKFFSEAVIEGLASDGGLFVPEKEFPKLNCGEWKSLVGATYVERAQILLEKCIHPADVPAARLGEMIEAAYGENFACSKIAPV
RHLSGNHFILELFHGPTGSFKDLSLQLMPHLFAHCIPPNCNYMILVATSGDTGSAVLNGFSRLNKNDKQRIAVATFFPENGVSDFQKAQIIGSQKENGWAVGVKSDFDFC
QTAIKRIFKDPDFTGFLTVEYGTVLSSANSINWGRLLPQVVYHASAYLDLVSQGFISFGSPVDVCIPTGNFGNILAAVYAKMMGIPIRKFICASNQNHVLTDFIKTGHYD
LRERKLAQTFSPSIDILKSSNLERHLHLMANKDGQLMTKLFNQLEEQHHFQIEKILVEKLQQDFVADWCSEGECLAAIHSTYNTSGYILDPHTAVAKVVADRMQDKTCPV
IISSTAHYSKFAPAILQALKIKEINQTSSSQLYLLSSYNALPPPHEALLERTKQPEKVEYQVCAADVDVLKSHVEKLIQSQFM*
3 >lcl|XP_001496335.1|Plus1complement(13092851..13093966) NW_001867402 4-hydroxyphenylpyruvate dioxygenase-like protein-like LOC100065467 __SEG__ Chr2 {Equus caballus} MAAPARSLCHIAFHVPAGQPLAQDLQRIFGFQPLAAREADGWRQLALRSGDAVFLVNEGGGRGEPLYGLDPRHAVPSATNLCFDVADVSAAARALASRGCSVPVAPVSVR
DAQGTATYAVVSSPAGNLSLTLLERAGFRGPFLPGFGHVPSATGPGWVSHVDHLTLACTPGSSPTLMRWFHDCLGFRHLPLSPGEDPELGLEVEAGSGRGGLRLTALQTP
PGSAVPTLLLAESLLGATDGQDQIEQFLAQHRGPGLQHVGLYTPNIMKATERVAVAGGQLLTPPSAYYLQPGKERQILAAGHEPSLLAQQGILLDGDKGKFLLQVFTKSL
FAEDTFFLELIQRQGATGFGQGNIRALWQSVQEQAARGQEA*
4 >lcl|XP_001496502.1|Plus1complement(24539073..24540029) NW_001867413 ribose-phosphate pyrophosphokinase 1-like LOC100053121 __SEG__ Chr4 {Equus caballus} MPNIKIFSGSSHQDLSQKIADRLGLELSKVMTKKFTNQETCVDIGESVHGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDENRAPISAK
LVANMLTIAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLRWIRENISEWRNCIIVAPDAGGAKRVTSIADRLNVDFALIHKERKKASKVDHMVLVGDVKDRVAILVD
DIADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAITRINSACLEAVVVTNTIPQEDKMKHCSKIQVIGIAMILAEAIRKTHNGESVSYLFSHVPL*
5 >lcl|XP_001503727.1|Plus19065830..9067071 NW_001867364 inactive serine protease 35 PRSS35 __SEG__ Chr10 {Equus caballus} MENMLLWLLFFTLGRTLTDGSEMEQDFMWHLRKIPRLVSERTFHLTSPTFEADAKMVLNRACGIECRKELPAPSLSELEHSLAYETVFENGTRTLTTVKVQGLVLEPTQN
ITTRGASVRRRRQVYGTDSRFSILDKRFLTNFPFNTAVKLSTGCSGILISPNHVLTAAHCVHDGKDYIKGTKKLRVGLLKMRNKGGGKKRRGARRSRREANGGDQREGSE
ENLKERTKAGRRRKGSGRRHRVAEGQPSFQWTRVKNTHIPKGWVRGGSGDAALDYDYALLELKRAHRKKYMELGISPTIKKLPGGMIHFSGFDHDRADQLVYRFCSVSDE
SNDLLYQYCDAESGSTGSGVYLRLKEPDNKNWKRKIIAIYSGHQWVDVHGVQKDYNVAVRITPLKFAQICLWIHGDDAKCTYG*
6 >lcl|XP_001503875.1|Plus119589063..19590142 NW_001867364 alpha-(1,3)-fucosyltransferase-like LOC100071396 __SEG__ Chr10 {Equus caballus} MTPASKGILRPFLIVCIILGCFVACLFIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILIWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHH
RDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQ
AFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNDKLYLSYFNWRKDFTVNLPRFW
ESHACLACDHVKRHQEYKSVGNLEKWFWN*
7 >lcl|XP_001917534.1|Plus1complement(38570195..38571298) NW_001867396 alpha-(1,3)-fucosyltransferase-like LOC100067846 __SEG__ Chr25 {Equus caballus} MAVSVWSLGNPELGGWGLWLSPRRQPLFAWHGPTQRLRALVSLAGVALLMALWLLWLLQSSPGGAPMPQPTLTILIWHWPFTYPPPELPSNTCTSYGVARCHLSTNRSLL
ATADAVVFHHRELRDGRIRLPLAERPRGQPWVWASMESPSNSHGLSDFRGIFNWVLSYRRDSDIFVPYGRLEPREGPAPPLPPKDRVAAWVVSNFRERQRRVQLYRQLAP
HLQVDVFGRANRRPLCASCLLPTVSRYRFYLSFENSQHRDYITEKLWRNALAAGAVPVVLGPPRATYEAFVPPDAFVHVDDFGSARELAAFLTGMNESSYRRYFAWRDRL
RVRLVEDWRERFCAICARYPHLPRSQVYQDLQGWFQS*