SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Cfam E    

ID / Description / Sequence
1 >lcl|NP_001005378.1|Plus128985874..28986926 NW_876272 fucosyltransferase 5 FUT5 __SEG__ Chr20 {Canis lupus familiaris} MRWSQEEPVWFSMSRTNTAESPAMAPNGSAGPVTSQGAPCQATRGSSACRPLLLLLWTWPFHHPVALSPCSDMWPGTTDCRLTANRSVYPEADAVLVHHREVSYRPKEQL
PTSPRPPGQRWVWFSMESPSHCAQLKALDGYFNLTMSYRRDSDIFTPYGWLEPWPGQPAAPLVNLSAKTELVAWVVSNWREDSVRVRYYHKLQAHVQVDVYGQRHKPLPQ
RNMIQTLSQYKFYLAFENSLHRDYITEKLWRNALDAWAVPVVLGPSRKSYEQFLPADAFIHVDDFQNPKDLAQYLLSLDKDDARYLAYFRWRETLRPRTFSWSLMFCKAC
WRLQQESAYQTVPSIASWFT*
2 >lcl|NP_001005379.1|Plus1839573..840640 NW_876333 alpha-(1,3)-fucosyltransferase FUT7 __SEG__ Chr9 {Canis lupus familiaris} MGPWGKPGKTASPVSHVGYSLSRRLRAVGVLAGAALLSAIWLLWLLGSPPTGGPAPPHTLIILIWHWPFSDRPPELPSNTCISFGVAHCHLSTNHSLLASADAVVFHHRE
LQTQQARLPLAKRPRGQPWVWVSMESPSHTHGLGRLGGIFNWVLSYRRDSDIFVPYGQLEPHQGPAPPLPAKKRVAAWVVSNFQERQRRVQVYRQLAPHLQVDVFGRANR
QPLCANCLLPTVAQYLFYLSFENSQHQDYITEKFWRNALAAGTVPVVLGPPRATYEAFAPADAFVHVDDFSTAQELASFLANMNESHYRRYFAWRDRLRVRLFGDWRERF
CAICTHYPHLPRGQVYQDLQGWFQA*
3 >lcl|NP_001005380.1|Plus154774098..54775177 NW_876254 alpha-(1,3)-fucosyltransferase FUT9 __SEG__ Chr12 {Canis lupus familiaris} MTSASKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILIWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHH
RDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQ
AFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFW
ESHACLACDHVKRHQEYKSVGNLEKWFWN*
4 >lcl|XP_003432328.1|Plus19777295..9777729 NW_876264 L-asparaginase-like LOC100686138 __SEG__ Chr17 {Canis lupus familiaris} MGVAGGEMGGGGWGNWELRTSTGGIINKMVGRVGDTPCIGSGGYADNDIGAISTTGHGESILKVNLARLTLFQVEQGKTLEEAADMSLGYMKSKLKGLGGVTLVSKAGDW
AVRWTSASMPWAAAKDGKLHSGIDLEETSVTDLP*
5 >lcl|XP_003432843.1|Plus128969826..28970977 NW_876272 galactoside 3(4)-L-fucosyltransferase-like LOC100683739 __SEG__ Chr20 {Canis lupus familiaris} MDPHILAKIRCPWRHYLFGVLFQLLLALCFFSYMRWSQEEPVWFSMSRTNTAESPATAPNGSAGPVTSQGAPCQATRGSSACRPLLLLLWTWPFHHPVALSPCSDMWPGT
TDCRMTANRSVYPEADAVLVHHREVSYRPKEQLPTSPRPPGQRWVWFSMESPSHCAQLKALDGYFNLTMSYRRDSDIFTPYGWLEPWPGQPAAPLVNLSAKTELVAWVVS
NWREDSVRVRYYHKLQAHVQVDVYGQRHKPLPQRNMIQTLSQYKFYLAFENSLHRDYITEKLWRNALDAWAVPVVLGPSRKSYEQFLPADAFIHVDDFQNPKDLAQYLLS
LDKDDARYLAYFRWRETLRPRTFSWSLMFCKACWRLQQESAYQTVPSIASWFT*
6 >lcl|XP_003432991.1|Plus1complement(6388269..>6389351) NW_876273 alpha-(1,3)-fucosyltransferase-like LOC100682680 __SEG__ Chr21 {Canis lupus familiaris} GGGRRGRGCGAPALAAAGLLCTALAAYSCWGQLPPPPWAPPAPPRPVGVLLWWEPFAGRAGGARRPPDCWLRFRIRGCRLLADRAAYGEAQAVLFHHRDLVRGAPDWPPP
WGGHPRPPGQRWVWMNFESPSHSPGLRHLAGDLFNWTLSYRADSDVFVPYGRLYPRAHPGDPPPGPAPPLARKRGLVAWVVSNWDERQARVRYYRQLSRHVPVDVFGRAG
PGRPVPDSGLLHTVARYKFYLAFENSQHPDYITEKLWRNALLAGAVPVVLGPDRANYERFLPRGAFIHVDDFPSASSLAAHLLFLDRNPAVYRRYFHWRRSYAVHITSFW
DEPWCRACQAVQAAGDRPQSVRNLARWFER*
7 >lcl|XP_003433570.1|Plus126059330..26061090 NW_876284 cationic amino acid transporter 3-like LOC100686753 __SEG__ Chr27 {Canis lupus familiaris} MLCQELHIFGNKLVRRRPLKKDVTDIAPDRSLSTMDLVALGVDNTVGVGVYILAGEVANSQAGPSTMICFLVAGLTSVLAGLCYSEISARVPQSGSAYLCTYVTIGELGA
FITGWNLILFFVAGTTIVACAWSLAFNNLPGNQISQALHESISPHVPRVFAEYLDFFVVGLVLLLIGLLTLRITEFSLATKAFTLVKVLVLSFIIMSGFIKGDLHNWKLT
EEDYIKAGLNDTSSLGPLGSGGFVPFGFQGILRGAATCFYAFIGFDNIVTRVEEAQNPKCSIPRGTVISLLICISVYFGVSAALTLMVPYYQLRAGSTLPEVFLHIGWAP
AYYAVAFGFLCSLSVSLLGFMVPIRHQVYMMAKDGLLFPVLARIHTGTYTRMVATVIFGIIAAIMIVFFGLTHLVDLRSIVTLLNYSLVAFSVLILRYQPERKNGGNEAQ
VQQENGPEAEQLTLRRIFFPDSSTPTPLSGLIVSVCSSLLALLLTLLCLVLAQWPGLLSGDPWWITVVVLLLVLITGITGVIWRQPQSSTPLYFKVPGLPLLPLLSIFLN
FYLMMQMPAGTWAQFGVWMLIGFAIYFGYGMQHSLA*
8 >lcl|XP_535167.1|Plus1complement(2660139..2662370) NW_876290 threonine synthase-like 1 THNSL1 __SEG__ Chr2 {Canis lupus familiaris} MLHFNRCPHLKQIAQKCFSSIHVRTDKHVQLFLSRTFALAEFRKSWHSTHSVVGDKNIILMGPPGAGKTTVGRIIGQKLGCCVIDVDDDILEKTWNMSVSEKLQDVGNEQ
FLEEEGKAVLNFSASGSVISLTGSNPMHDASMWHLKKNGIIVYLDVPLIDIVSRLKLMKIDRIVGQNAEISLKDLLKFRRQYYKKWYDTRVFCESGASPEEVADKVLKAV
KRYQDVDSETFISTRHIWPKDCERKVSTKFFSEAVIEGLASDGGLFVPEKEFPKLNCREWKSLVGATYIERAQILLEKCIHPADIPAARLGEMIETAYGENFACSKIAPV
RHLSGNQFILELFHGPTGSFKDLSLQLMPHLFAHCIPPSCNYMILVATSGDTGSAVLNGFSRINKNDKQRIAVATFFPENGVSDFQKAQIIGSQKENGWAVGVKSDFDFC
QTAVKGIFKDSDFTGFLIMEYGTVLSSANSINWGRLLPQVVYHASAYLDLVSQGFISFGSPVDVCIPTGNFGNILAAVYAKMMGIPIRKFICASNQNHVLTDFIKTGHYD
LRERKLTQTFSPAIDILKASNLERHLHLVADKDGELMTKLFSQLEEQHHFQIEKMLVEKLQQDFVADWCSEGECLAAIHSTYNTSGYILDPHTAVAKVVADRMQDKTCPV
IVSSTAHYSKFAPAIMQALKIEEINHNSSSQLYLLSSYNALPPPHEALLERTKQQEKMEYQVCAADVNVLKSHVEKLIQSQFI*
9 >lcl|XP_539633.1|Plus1complement(15032877..15034076) NW_876259 4-hydroxyphenylpyruvate dioxygenase-like isoform 1 HPDL __SEG__ Chr15 {Canis lupus familiaris} MAAHARRLCHVAFHVPAGQRLARDLRRLFGFQPLAVREAEGWRQLALRSGDAVFLVNEGAGPRQPLYGLDPRHEVPSATNLCFDVADAGAAARALVARGCSVPVPPVSVK
DAQGTATYAVANSPAGNLSLTLVERAGFRGPFLPGFQSVPSAAGPGWVSHVDHLTLACTPGSSPTLMRWFRHCLGFRHLPLSPGEDPEVGLEVTAGSGRGGLKLTALQSP
PGSAVPTLVLAETLPGASSGQDQVEQFLARHRGPGLQHVGLYTPNIVEATEGVAVAGGQLLAPPEAYYQQPGKERQILAAGHEPSLLARWGILLDGEDGKFLLQVFTKSL
FPEDTFFLELIQRQGATGFGQGNIRALWQSVQEEQAARDQEARRWGLGSASCPGAQGRLELRNTCKGLE*
10 >lcl|XP_540979.3|Plus1complement(21404793..>21406289) NW_876267 LOW QUALITY PROTEIN: glutamate dehydrogenase 1, mitochondrial GLUD1 __SEG__ Chr19 {Canis lupus familiaris} PNFFKTVEGFFDRGASIAEDKLVEDLRTRETEEQRRNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTGVSVDEVKALASLMTYKCA
VVDVPFGGAKAGVKINPQNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISHGGIHGRISATGRGVFHGIENF
INEASYMSILGMTPGFGDKTFVVQGFGNVGLHSMRYLHRFGAKCVGVGESDGGIWNPDGIDPKELEDFKLQHGSLLGFPKAKPYEGSILEADCDILIPAASEKQLTKSNA
PRVKAKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGTIPVVPTAEFQDRRTS*QEA
SEKDLVHSGLAYTMEHSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGVTFT*
11 >lcl|XP_542268.1|Plus1complement(12792884..12794023) NW_876273 serine protease 23 PRSS23 __SEG__ Chr21 {Canis lupus familiaris} MAGIPGLLFLLLLLLLCAVGQVSPSGTHWKPTWPAYRLPVVLPQSTLHLGKPDFGAEAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYVLSGG
SGGQESSGKARRKRQIYGYDSRFSIFGKDFLLNYPFSTSVKLSTGCTGTLVAERHVLTAAHCIHDGKTYVKGTQKLRVGFLKPKFKDGGRGANSSSSAIPEKMKFQWIRV
KRTHVPKGWIKGNANDIGMDYDYALLELKKPHKRKFMKIGVSPPAKQLPGGRIHFSGYDNDRPGNLVYRFCDVKDETYDLLYQQCDAQPGASGSGVYVRMWKRQQQKWER
KIIGIFSGHQWVDMNGSPQDFNVAVRITPLKYAQICYWIKGNYLDCREG*
12 >lcl|XP_542534.3|Plus143377127..43378290 NW_876273 isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial-like LOC485415 __SEG__ Chr21 {Canis lupus familiaris} MALKILTAASCCVKSMLRPCNLCRSWEILCGHETSPRSFSFKSSIPPSAKYGGRHTVTMIPGDGIGPELMLHVKTVFRHACVPVDFEEVVVNCTSCEEDIHNAIMAVRRN
RVALKGNLETDHNLPPSHKCRNNMFRTTLDLYANVIHFKSLPGVETQHKDVDILVVRENTEGEYSNLEHESVTGVIESLKIITKAKSFRIAQYAFQLAQEMERKKVTVVH
KANIMKLGDGLFLQCCREVASHYPQLTFEGMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNSICTGLVGGAGLVPGANYGHTHAVFETASRQSARNLANKNIANPTAMLL
ASCIMLDYLQLHSYATSIRAAVLASMENKNVHTPDIGGQSTTLDFIHNIIDHINTVH*
13 >lcl|XP_543630.1|Plus1complement(1471215..1473053) NW_876284 cationic amino acid transporter 3-like LOC486504 __SEG__ Chr27 {Canis lupus familiaris} MLCQALCRFGEKLVRKHTLEQYVAKISAAGSLRTVDIVALGVGNTVGAGVYVLAGEVTSDRAGPAVAICFLAAALPSVVAAVCHAELGARAPRSASAYLHNYVTGGELGA
FLTGWSLILSGVTGAASMARAWSSAFDNLMGNRLSGALREHVSLSAPHVLAGHPDFFAAGLVLLLTALLALRASEFVLATSAFTVVNVLVLSFVIISGFIKGDLHNWKLT
EEDYTLTVSRLNDTSGLGPLGSGGFVPFGFEGVLRGTASCLYAFAGFDSILAAAEEAQDPQRSAPVGIVISVFICFLVYFGVSSALTLLVPYYQLQPGSPLPEAFLHIGW
ASARYVVASGALCALSTGILDSMFLSRWMLYVMANDGLLFRVLARLYARTGIPVVATVALGIITAFVTLLFGLTDLVDLMSIGTLLTYSLVALCVLIARYQPEMKDEDDE
AGAQQEDVPAAEKLTLRGLFCPGSPTPTALSGLVVYVCSSLLALLLTLLGLVLAQWPILLLSGDPGWITAVVLLLVLITGITGVIWRQPQSSTPLYFRVPALPLLPLMSI
FMNVYLMMQMAAGTWARFGVWMLIGFAIYFGYGIQHALRIKPTLVRPQTEDLELSSASTYSI*
14 >lcl|XP_544812.3|Plus1complement(<7316934..7317884) NW_876295 ribose-phosphate pyrophosphokinase 1-like LOC487688 __SEG__ Chr31 {Canis lupus familiaris} MPNMKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGEGVRGEDVYIVQSGCGEISDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKEKSPAPISAK
LVADMLRVEGADRIITVDLQASQIQGFFDVPVDNLYAAPAVLQWIRESVSEWRDCTIVSPDAGGAKTVASIADRLNVHFAPVHRGRKKADEVDRVVLVGDVKDRVAILVD
DMADTCGTICLAADKLLSAGDSRVYAVLTHGILSGPAISRINSACFEAVVVTNTIPQEDKTKHCSKIQVIDISAILAEAIRRTHNGESVSCLFSHVP