SinEx DATABASE 1.1
Database for Single Exon Coding Sequences in Mammalian Genomes
Home Statistics Tutorial Download New

Home > Sequences Btau E    

ID / Description / Sequence
1 >lcl|NP_001030534.2|Plus11878781..1880019 NW_001495544 inactive serine protease 35 precursor PRSS35 __SEG__ Chr9 {Bos taurus} MGAMFFGLMLFTLGWTLIDGSESEQDFMWHVRKIPRLVSERTFHLTSPAFEADAKMVLNRVCGIECQKDLPAPSLSDLEDSLSYETVFENGSRTLTRVKVQGWVPEPTQN
LTSQGAPVRRKRQVYGTDSRFSILDKKFLTNFPFNTAVKLSTGCSGILISPTHVLTAAHCVHDGNGYIKGSKKLRVGLLKMRNKGGGKRRRGSRRNRREVSGAGREGSQD
SLKETAKAGRRRKGSARRQRAADGRPSFQWTRVKNTHIPKGWARGESGDPALDYDYALLELKRPHKKKYMELGVSPTIKKLPGGMIHFSGFDQDRADQLVYRFCSVSDES
NDLLYQYCDAESGSTGSGVYLRLKEPDKKRWKRKIIAIYSGHQWVDVHGVQKDYNVAVRITPLKYAQICLWMHGDDANCTQG*
2 >lcl|NP_001033667.1|Plus1complement(396773..398020) NW_001494996 hypothetical protein LOC615630 C5H12orf12 __SEG__ Chr5 {Bos taurus} MTQTLDTKEDPLNLGGGWASSAPLRTWSFGPRRRRGAPVYRRRPRYGPKAEYEPPRKQAKQQYGPGPWFQPPWRPYWAVYSNWGRWRGPWCPPPAGFRKPPGRVQVIRVY
GLHPLCLCCCSCCHGPWNPGWARPPGRKKRWGRRGRGLRRHPRRSAQRSPPVDLSTLLRPVNLYGWRAPGMRAPRNTTQFIMNQIYEDMRQQEKLERQQEALRAQQAQAA
STASPEGAFGNDVPPSGGQEDEELQDTLYSFVRNPSLVFSPDPDEEKQTATSQLVEEEEEGEREEEEEEWCDEEECDGKELESQEEDEESEAKDEEDEESEAKDEEEGEE
ADYMEEREEEDEEDEAEEIAEEEEGLAEDEQTEEENHLPLEMPLSFLVGAEEERENFMNCTYLSPKQGIPKVAQEALFMVQDINC*
3 >lcl|NP_001092841.1|Plus1complement(2528972..2530144) NW_001494824 glyoxalase domain containing 1 HPDL __SEG__ Chr3 {Bos taurus} MAAPVRRLCHIAFHVPAGLPLARDLQRLFGFQPLAVREADGWRQLALRSGDAVFLVNEGAGPGEPLYGLDPHHGIPSATNLCFDVADAGAAARGLAALGCSVPVPPVSVR
DEQGTATYAVVSSPAGNLSLTLLERTGFGGPFLPGFSPVPSTPGPGWFSHVDHLTLACNPSSSPKLLHWFHDCLGFHHLPLSPGEDPELGLEVAAGSGLGGLRLTALQGP
VGSAVPTLVLAESLPRATSGQDQVEQFLARNRGPGLQHVGLYTPSIKEATEGVAGAGGQLLTPPKAYYQQPGKEEQILAAGQEPNLLARQGVLLDGDRGKFLLQVFTKSL
FAEDTFFLELIQRQGATGFGQGNIRALWQSVQEQAARVQEACKGPKLDAAGCPGALESSA*
4 >lcl|NP_001095953.1|Plus1complement(1887354..1888343) NW_001494872 phosphoribosyl pyrophosphate synthetase 1-like 1 PRPS1L1 __SEG__ Chr4 {Bos taurus} MDAKSLLQLTKKPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKLSNQETCVEIGESVQGEDVYIVQSGCGEINDNLMELLIMINACKIASAGRVTAVIPCFPYARQDK
RGESRAPISAKLVADMLSTAGADHIITMDLHASQIQGFFDIPVDNLCAEPAVLKWIKEQISDWRSCTIVSPDAGEVKRATSIADRLNVDFALIHKVRKKAGEVDGMVLVG
DVKYRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAVTRINSAGFEAVVVTNTVPQEDKMKHCSKIQVIDISMILAEAIRRIHSGKSVSYLFSHVPL*
5 >lcl|NP_777160.1|Plus1complement(1217709..1218788) NW_001495571 alpha-(1,3)-fucosyltransferase FUT9 __SEG__ Chr9 {Bos taurus} MTSASKGILRPFLIVCIILACFMVCLFIYIKPTNSWIFSPMESASSVLKMKNFFSTKTGDFNETTILIWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHH
RDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPNKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQ
AFGEYVTDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFW
ESHACLACDHVKRHQEYKSVGNLEKWFWN*
6 >lcl|NP_777161.1|Plus1complement(319919..321115) NW_001493280 fucosyltransferase 4 FUT4 __SEG__ Chr15 {Bos taurus} MRARWGRRGARRGGPGLPGTHLALLAASLLSTAVAIYVCWKQLPPLPWASPSPPRPVNVLLWWEPFRGRHNPRRPPPDCQRRFNISGCVLHTDRAAYEEAQAVLFHHRDL
VKGPPDWPPPWGVQMPPVEEREGLVMDDEGQEAEAETSAALGPRPPGQRWVWMNFESPSHSPGLQGLAGNIFNWTLSYRADSDIFVPYGYLYPRTHPSEQPPGLVPPLAR
KQGLVAWVVSNWDERQARVRYYRQLSQYVTVDVFGKGGPGQPLPDAELVHTVARYKFYLAFENSQHLDYITEKLWRNAFLAGAVPVVLGPNRTNYERFVPSNAFIHVDDF
PSASSLAAHLQFLDRNPTVYRGYFRWRRSHAVHVTSFWDEPWCLACQAVQKAGNQRKSVPNLAGWFQQ*
7 >lcl|XP_001255587.1|Plus12924172..2926418 NW_001493113 hypothetical protein THNSL1 __SEG__ Chr13 {Bos taurus} MLHFKRCQLLKQIAQKCLSRIHVKTDKHPQLFLSRTFALAELRKSWHSIYSLVGDKNIILMGPPGAGKTTVGRIIGQKLGCCVIDVDDDILEKTWNMSVSEKLQDVGNEQ
FLEEEGKAVLNFSASGSVISLTGSNPMHDASMWHLKKNGIIVYLDVPLLDIVSRLKLMKTDRIVGQNSGTSMKDLLKFRRQYYKKWYDTRVFCESGASPEEVANKVLSAV
KRYQDVASETFISTRHIWPKDCEQKIPAKFFSEAVIEGLASDGGLFVPEKEFPKLNCGEWKSLVGATYIERAQILLEKCIHPADIPAAKLGEMIETAYGENFTCSKIAPV
RHLSGNQFILELFHGPTGSFKDLSLQLMPHLFAHCIPPSCNFMILVATSGDTGSAVLNGFSRLNKNDKQRIAVATFFPEDGVSDFQKAQIIGSQNENGWAVGVKSDFDFC
QTSIKRIFQDSDFTGFLAVEYGTVLSSANSINWGRLLPQVVYHASAYLDLVSQGFISFGSPVDVCIPTGNFGNILAAVYAKTMGVPIRKFICASNQNHVLTDFIKTGHYD
IRERKLARTFSPAIDILKSSNLERHLHLMANKDGQLMRRLFNQLEEEHHFQIEKILVEKLQQDFVADWCSEGECLAAIHSTYNTSGYILDPHTAIAKVVADRMQDKTCPV
IVSSTAHYSKFAPAIMQALKIREINQTSSSQVYLLSSYNALPPPHEALLERTKQQEKMEHQVCVADVNVLKNYVEKLAQNQFIGKFSE*
8 >lcl|XP_002704911.1|Plus1complement(4005803..4007020) NW_001495368 CTH protein-like LOC100297420 __SEG__ Chr7 {Bos taurus} MQEKEASPHGFLPRFQHFATQAIHVGQEPEQWTSQAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYSLAFASGLAATVTITHLLKAGDQIICM
DDVYGGTNRYFRQVATEFGLKISFVDCSKPKLLEAAITPETKLVWIETPTNPSLKMIDIEACAHTVHKHGDIILVVDNTFMSAYFQRPLSLGADICMYSATKYMNGHSDV
VMGLVSLNSESLHDRLRFLQNSLGAVPSPIDCYLCNRGLKTLQVRMEKHFENGMAVAQFLESNPQVEKVIYPGLPSHPQHELAKRQCTGCPGMVTFYIKGSLQHAETFLK
NLKLFTLAESLGGYESLAELPAIMTHASVPKSDREVLGISDTLIRLSVGLEDKQDLLDDLDQALKAANPPNASSN*
9 >lcl|XP_584988.1|Plus113323..13844 NW_001492802 glycine cleavage system H protein, mitochondrial-like GCSH __SEG__ Chr10 {Bos taurus} MALHAVRSVRAAVGSLRAISAPSAPCSPRPWEVRADAVWALRTGPALLSVWKFTEKHEWVTTENGVGTVGISNFAREALGDVVYCSLPEVGTKLNKQEEFGALESVKAAS
ELYSPLSGEVTEINKALAENPGLVNKSYYEDVWLIKMTFSNPSELDELMSEEAYEKYIKSIEE*